DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52b and Ir60e

DIOPT Version :9

Sequence 1:NP_725469.2 Gene:Ir52b / 246631 FlyBaseID:FBgn0050469 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_611927.3 Gene:Ir60e / 37917 FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster


Alignment Length:613 Identity:137/613 - (22%)
Similarity:229/613 - (37%) Gaps:125/613 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLCFLGYMAAHIADISVQNQSLMDNELINLLLKLRNEEFYDTLLVYGKDCEFHSVIKNVDVAVV 70
            :|||.:|...:.    |:|.|.|.|   :||.|:.....|.|.     :.|....::..:|...:
  Fly    13 VLLCLVGASDSE----SMQVQVLQD---LNLALQTELNVFIDF-----ECCATSEILHKLDSPRI 65

  Fly    71 LVSDS------MNFEWNFSSLTLILSCGPDIDNGGPNSTSIKLQR------NRRLVLL--KEDFQ 121
            |:|.:      :....||:..|||:....|.|. .|...|: |.|      ...:|.|  :|...
  Fly    66 LLSSNSREARDLRIRGNFTESTLIIVSVMDSDL-NPLVASL-LPRLLDELHELHIVFLSNEEPGF 128

  Fly   122 PSNICNIYTQKEQY-NIALVRENFTKSKSIYTCRYFQDPNVDEVNLSGTKPIF--IEQFQNMKGK 183
            |......|..||.: |:.|:     ..|.:|:  |...|::..::||.....|  ....:|.:|.
  Fly   129 PKQDLYTYCFKEGFVNVILM-----SGKGLYS--YLPYPSIQPISLSNVSEYFDRARIIRNFQGF 186

  Fly   184 AIRIVPDLLPPRVMLYQDANDGELKMIGYVANLITNFAQKVNATLQLDFLKPSTSITEISRMAKD 248
            .:||:...|.||...|.: ..|.|...||:...:.....:.|||::      |..|.::      
  Fly   187 PVRILRSTLAPRDFEYSN-EQGGLVRAGYLFTAVKELTYRYNATIE------SVPIPDL------ 238

  Fly   249 DELDMGITLEASLNTSNLETSSYPYLLTSYCLMVQVPAKFPYNLVYALIVDPLVLGIIFVLFLLL 313
            .|.|:.:.:...|:|..::...|   ...:.|.|...|  |.:::....:.|....|        
  Fly   239 PEYDVYLAVAEMLHTKKIDIVCY---FKDFSLEVAYTA--PLSIIREYFMAPHARPI-------- 290

  Fly   314 SVLLIYSQKMSWQ--DLSVANIL-------LNDKSLRGLLGQSFPFPL-----NASKKLRL---- 360
            |..|.||:...|.  .:.::.:|       |..:..|..:|:...:.|     |..:|:|:    
  Fly   291 SSYLYYSKPFGWTLWAVVISTVLYGTVMLHLAARGARVEIGKCLLYSLSHILYNCHQKIRVAGWR 355

  Fly   361 ---IFTILCFASIMLTTMYEAYLQSFFTNPPSEPEICSFQDVG-----SYNRRIAMSALEVNGLI 417
               |..||.....:||.:|.|.|.|..|:...:.|..:.:|:.     |.:.....|.::....:
  Fly   356 DVAIHGILTIGGFILTNVYLATLSSILTSGLYDEEYNTLEDLARAPYPSLHDEYYRSQMKAKTFL 420

  Fly   418 KTNNSHFREIRMDDLEIFDNMPECYELRDAFNLSYNYVVTGDRWRSYAEQQTLFKEPVFYFAR-- 480
            .      ..:|.:.|.:...:.:.|  ||..|.||.|::..||......||.|.|.|.|...|  
  Fly   421 P------ERLRRNSLSLNATLLKAY--RDGLNQSYIYILYEDRLELILMQQYLLKTPRFNMIRQA 477

  Fly   481 ------DLCFSRLIFLSVPLRRHLPYRHLFDEHMMQQHEFGFVNYWMSHSFFDMVRLGLTSLKDL 539
                  ..|.|          ..|||..:..|.|.:..|.|......:.:|.:::..|:.:|...
  Fly   478 VGFTLESYCVS----------NSLPYLAMTSEFMRRLQEHGISIKMKADTFRELIHQGIYTLMRD 532

  Fly   540 SRPLAYTPSLLMDDISWIMKIYLAAIVL 567
            ..|    |:...|     :..|..|.||
  Fly   533 DEP----PAKAFD-----LDYYFFAFVL 551



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.