DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52b and Ir56b

DIOPT Version :9

Sequence 1:NP_725469.2 Gene:Ir52b / 246631 FlyBaseID:FBgn0050469 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:414 Identity:90/414 - (21%)
Similarity:169/414 - (40%) Gaps:63/414 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 PRVMLYQDANDGELKMIGYVANLITNFAQKVNATLQLDFLK--PSTSITEISRMAKDDELDM-GI 255
            |...::.:......|..|....::.:||:..:..|.||.|:  |..|:.|...::....|.: |:
  Fly    21 PHAFIFNETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVVEQDIISGKYNLSLHGV 85

  Fly   256 TL--EASLNTSNLETSSYPYLLTSYCLMVQVPAKFP--YNLVYAL---IVDPLVLGIIFVLFLLL 313
            .:  |.:.:..|....|||..|.:.|:||.:..:.|  ..:|:.|   |...|.||..:|..|| 
  Fly    86 IIRPEETSDFFNATQHSYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIWTCLFLGTFYVALLL- 149

  Fly   314 SVLLIYSQKMSWQDLSVANILLNDKSLRGLLGQSFPFPLNASKKLR-------LIFTILCFASIM 371
                   :.:.|::...|........|..:....|...:|.|.||:       :.:|:|.....:
  Fly   150 -------RYVHWREPGNATRSYTRNVLHAMALLMFSANMNMSVKLKHASIRVIIFYTLLYIFGFI 207

  Fly   372 LTTMYEAYLQSFFTNPPSEPEICSFQDVGSYNRRIAMSALEVNGLIKTNNSHFREIRMDDLEIFD 436
            ||..:.:::.:|...|.....|.::.|:.....||.:           ::|...|:|.       
  Fly   208 LTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLRIVI-----------HDSLLEELRW------- 254

  Fly   437 NMPECYELRDAFNLSYNYVVTGDRWRSYAEQQTLFKEPVFYFARDLCFSRLIFLSVPLRRHLPYR 501
             :|....|..:.:.||.||||.|.|..:..||.:..:|.|:.:: :||..| |.::|:..:..:.
  Fly   255 -LPVYQALLASPSRSYAYVVTQDAWLFFNRQQKVLIQPYFHLSK-VCFGGL-FNALPMASNASFA 316

  Fly   502 HLFDEHMMQQHEFGFVNYWMSHSF-------FDMVRLGLTSLKDLSRPLAYTPSLLMDDISWIMK 559
            ...::.::...:.|..|||...:|       :..|.|....::.|:.....|        :||  
  Fly   317 DSLNKFILNVWQAGLWNYWEELAFRYAEQAGYAKVFLDTYPVEPLNLEFFTT--------AWI-- 371

  Fly   560 IYLAAIVLCVFCFLLEIGVDKWKR 583
            :..|.|.:....|.||:.:.:.|:
  Fly   372 VLSAGIPISSLAFCLELFIHRRKQ 395



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.