DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52b and Ir40a

DIOPT Version :9

Sequence 1:NP_725469.2 Gene:Ir52b / 246631 FlyBaseID:FBgn0050469 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster


Alignment Length:437 Identity:79/437 - (18%)
Similarity:146/437 - (33%) Gaps:129/437 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 DMGITLEA---------SLNTSNLETSSYPYLLTSYCLMVQVPAK---FPYNLVYALIVDPLVLG 304
            |:|::.|.         :|..|....:..|..|.. .|.:..|.|   :|:.::..:...|:..|
  Fly   320 DVGLSWERRKAIEFSFFTLADSGAFATHAPRRLNE-ALAIMRPFKQDIWPHLILTIIFSGPIFYG 383

  Fly   305 IIFVLFLLLSVLLIYSQKMSWQDLSVANI----------------LLNDKSLRGLLGQSFPFPL- 352
            ||         .|.|..:..|.:..|.::                ||..|....|.....|..| 
  Fly   384 II---------ALPYIWRRRWANSDVEHLGELYIHMTYLKEITPRLLKLKPRTVLSAHQMPHQLF 439

  Fly   353 ----------------------NASKKLRLIFTILCFASIMLTTMYEAYLQSFFTNPPSEPEICS 395
                                  ..:|.|.:::.|.  |:.:|..:|.|.|.|.|..|..||.|.:
  Fly   440 QKCIWFTLRLFLKQSCNELHNGYRAKFLTIVYWIA--ATYVLADVYSAQLTSQFARPAREPPINT 502

  Fly   396 FQDVGSYNRRIAMSALEVNGLIKTNNSHFREIRMDDLEIFDNMPECYELRDAFNLSYNYVVT--- 457
            .|.:.:             .:|......:.|.....||:.:|..|.:  |..:.|....|:.   
  Fly   503 LQRLQA-------------AMIHDGYRLYVEKESSSLEMLENGTELF--RQLYALMRQQVINDPQ 552

  Fly   458 -----------------GDRWRSYAEQQTLFKEPVFYFARDLCFSRLIFL---SVPLRRHLPYRH 502
                             |:.......::|||.....|.:.:...|:.::.   :|.::...|:..
  Fly   553 GFFIDSVEAGIKLIAEGGEDKAVLGGRETLFFNVQQYGSNNFQLSQKLYTRYSAVAVQIGCPFLG 617

  Fly   503 LFDEHMMQQHEFGFVN------YWMSHSFFDMVRL--GLTSLKD---LSRPLAYTPSLLMD-DIS 555
            ..:..:||..|.|.::      |...:...:..|:  |....|:   .||..:|..:::.. ::.
  Fly   618 SLNNVLMQLFESGILDKMTAAEYAKQYQEVEATRIYKGSVQAKNSEAYSRTESYDSTVISPLNLR 682

  Fly   556 WIMKIYL--------AAIVLCVFCFLLE---IGVDKWKRWMKFRNLQ 591
            .:...::        |.::|     |||   |.:|:.:.||....||
  Fly   683 MLQGAFIALGVGSLAAGVIL-----LLEIVFIKLDQARLWMLCSRLQ 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir52bNP_725469.2 None
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 3/17 (18%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 17/80 (21%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 25/155 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.