DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52b and Ir11a

DIOPT Version :9

Sequence 1:NP_725469.2 Gene:Ir52b / 246631 FlyBaseID:FBgn0050469 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster


Alignment Length:502 Identity:100/502 - (19%)
Similarity:170/502 - (33%) Gaps:161/502 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 IEQFQNMKGKAIRIVPDLLP------------------PRVMLYQDAND----------GELKMI 210
            |..|..:.||..:.:|||.|                  |..::|:...|          .| .:.
  Fly   211 INHFDRITGKPQQSMPDLYPVRNGHLGDCPFNVGAAHMPPHLIYKRHKDPPPASNVSIPAE-DLA 274

  Fly   211 GYVANLITNFAQKVNATLQLDF-LKPST-----SITEISRMAKDDELDMGI-TLEASLNTSNLET 268
            |...:|:...|:.:...:||.. .:||.     :::...|...|..:.:.| .|..|....:|.:
  Fly   275 GIDWDLLQLLAKALKFRIQLYMPQEPSQIFGEGNVSGCFRQLADGTVSIAIGGLSGSDKRRSLFS 339

  Fly   269 SSYPYLLTSYCLMVQVPAKFPYNLVYALIVDPLVL-------GIIFVLFLLLSVLLIYSQKMSWQ 326
            .|..|..:::.::|:...       |...:.||:|       |:|.|: |||:||     ...| 
  Fly   340 KSTVYHQSNFVMVVRRDR-------YLGRLGPLILPFRGKLWGVIIVI-LLLAVL-----STCW- 390

  Fly   327 DLSVANILLNDKSLRGLLGQSFPF----------PLNASKKLRLIFTILCFASIMLTTMYEAYLQ 381
                         ||..||.|.|.          |:...:.....|.....||.||.|:...   
  Fly   391 -------------LRSRLGLSHPIEDLLTVIVGNPIPDHRLPGKGFLRYLLASWMLLTLVLR--- 439

  Fly   382 SFFTNPPSEPEICSFQ----DVGSYNRRIAMSALEVNGLIKTNNSHFREIRMD--DLEIFDNMPE 440
                        |::|    ||...:|...:.. :::||||.|.:.......|  .||:....|.
  Fly   440 ------------CAYQARLFDVLRLSRHRPLPK-DLSGLIKDNYTMVANGYHDFYPLELTCRQPL 491

  Fly   441 CYELRDAF-------------------NLSYNYVVTGDRW---RSYAEQQTLFKEPVFYFARDLC 483
            .:..|  |                   ||:|        |   .....:.|..::|::.:...:.
  Fly   492 DFSAR--FERVQRAAPDERLTTIALISNLAY--------WNHKHPNISRLTFVRQPIYMYHLVIY 546

  Fly   484 FSRLIFLSVPLRRHLPYRHLFDEHMMQQHEFGFVNYWMSHSFFDMVRLGLTSLKDLSRPLAYTPS 548
            |.|..||...:.|.:  :.|....:|...|..::.|                 ::..:..:..|.
  Fly   547 FPRRFFLRPAIDRKI--KQLLSAGVMAHIERRYMQY-----------------ENKRKVASNDPV 592

  Fly   549 LLMDDISWIM----KIYLAAIVLCVFCFLLEI----GVDKWKRWMKF 587
            ||......||    :|:...|||....|:||:    ...:.:|||::
  Fly   593 LLRRITKSIMNGAYRIHGLVIVLATGMFILELLAGRSNGRLRRWMEW 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir52bNP_725469.2 None
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 9/49 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.