DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir52c and Ir92a

DIOPT Version :9

Sequence 1:NP_725470.1 Gene:Ir52c / 246630 FlyBaseID:FBgn0050468 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:349 Identity:69/349 - (19%)
Similarity:137/349 - (39%) Gaps:68/349 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 YDAI---SYPYLMSSYCFMAPLPDSLPFSDVYMAIVAP------SILIMFLIIFCICSVLIIYIQ 326
            ||.|   |:....||...:.|.|..||   .:...:.|      .:||..|:   ||...:.:::
  Fly   345 YDGITETSHTIARSSVTILGPAPAPLP---SWRTNIMPFNNRAWLVLISTLV---ICGTFLYFMK 403

  Fly   327 ERSYR------------SLTIRSVLMNDICLRGFLAQPFPFPRQYNRKLKLIFM--LVCFSSLIS 377
            ..|||            |..:...:::...|  |:.|| ..|..::|.....|:  ::| :::..
  Fly   404 YVSYRLRYSGTQVKFHHSRKLEKSMLDIFAL--FIQQP-SAPLSFDRFAPRFFLATILC-ATITL 464

  Fly   378 TTMYTAYLQAFLWGPPIEPRLTSFDDVKKSRYTMA------INIYEREFLEALNVSLEDVEIYDY 436
            ..:|:..|::.|..|.....:.:.:...:|.:..:      ::..:...||...:...:.|::||
  Fly   465 ENIYSGQLKSMLTFPFYSAPVDTIEKWAQSGWKWSAPSIIWVHTVQSSDLETEQILARNFEVHDY 529

  Fly   437 GKFSKLRSTFNTNYLFPVTALQWFTIN----EEQKLFKYKIFYYCDAFCLNQFDIL-SIPLRRHL 496
            ...|.:  :|..||.|.:..|...:::    ...:..:.:|..:.|.:    ||.. ::.:|..:
  Fly   530 SYLSNV--SFMPNYGFGIERLSSGSLSVGDYVSTEALENRIVLHDDLY----FDYTRAVSIRGWI 588

  Fly   497 PYRDIFEEHMLLQKEFGLTKYW----IDQSYRD-------MIRANLTTFKDFSPLLENDYIEVHN 550
            ...:: .:|:...:|.||..:|    ||: |.|       |..||....|.....|     :|.|
  Fly   589 LMPEL-NKHIRTCQETGLYFHWELEFIDK-YMDKKKQEVLMDLANGHKVKGAPQAL-----DVRN 646

  Fly   551 LYWVFTMYFVGMGMGLCFFILEIL 574
            :.....:...|:....|..:.|:|
  Fly   647 IAGALFVLAFGVAFAGCALVAELL 670



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.