DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant9 and Galntl5

DIOPT Version :10

Sequence 1:NP_725602.1 Gene:Pgant9 / 246627 FlyBaseID:FBgn0050463 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_080725.2 Gene:Galntl5 / 67909 MGIID:1915159 Length:431 Species:Mus musculus


Alignment Length:158 Identity:39/158 - (24%)
Similarity:60/158 - (37%) Gaps:35/158 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 SQRLRALQDNPIEKPPVGVDNEAYADDEVVAVAAEKIIGYGELVAALQRLQG---HLNKHGLAAL 479
            :|..|..|..|:.......|:|...:|:     ||:..|...|.|.|..|:.   |...||..::
Mouse   272 AQAQRTQQHQPLFFDLGNTDSEEEGEDD-----AEEERGEKRLAAHLPSLKPSGLHHVLHGCQSI 331

  Fly   480 AGRVTAAQSLLLGPGIARALAVRTA-VLERRRPKIP--NPICPNAQALAKD------CVESLAQS 535
            |.|             .|.|..:.| ::..||.|.|  |.:.|:.....:|      ...||..|
Mouse   332 ATR-------------ERELETKVARLMGSRRTKAPELNLVSPSNVGEGEDMTYLLFTTGSLTYS 383

  Fly   536 RSQTAIE--LCDLLSTYEMEGLLLAHDR 561
            ..|..|:  :.|.::|.   |.:|..:|
Mouse   384 PHQIGIKRIMPDQMTTC---GPVLGEER 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant9NP_725602.1 tolA <91..>134 CDD:236545
pp-GalNAc-T 213..510 CDD:133004 22/95 (23%)
beta-trefoil_Ricin_Pgant9-like 518..643 CDD:467340 12/52 (23%)
Galntl5NP_080725.2 Catalytic subdomain A 114..224
pp-GalNAc-T 118..414 CDD:133004 39/158 (25%)
Catalytic subdomain B 282..344 18/79 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.