DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant9 and Galntl5

DIOPT Version :9

Sequence 1:NP_001097342.1 Gene:Pgant9 / 246627 FlyBaseID:FBgn0050463 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_001020319.1 Gene:Galntl5 / 499968 RGDID:1565271 Length:443 Species:Rattus norvegicus


Alignment Length:372 Identity:166/372 - (44%)
Similarity:227/372 - (61%) Gaps:23/372 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 GWTKNAFNQYVSDLISVHRTLPDPRDAWCKDEARYLTNLPKTDVIICFHNEAWTVLLRTVHSVLD 234
            |.::...|...|..:.:.|.:||.|:..|: :..|..|||...|||||:||.:..|||||.||::
  Rat    82 GLSRYGLNVITSRRLGIERQVPDSRNKICQ-QKHYPFNLPTASVIICFYNEEFNTLLRTVSSVMN 145

  Fly   235 RSPEHLIGKIILVDDYSDMPHLKRQLEDYFAAY-PKVQIIRGQKREGLIRARILGANHAKSPVLT 298
            .||:||:.:||||||.|:...||.:|:.:...: .|::::|.:|||||||:|::||:.|...:|.
  Rat   146 LSPKHLLEEIILVDDMSEFDDLKAKLDYHLEIFRGKIKLVRNKKREGLIRSRMIGASRASGDILV 210

  Fly   299 YLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVISDETLEYHYRDSGGVNV-GGFDWNLQFSWH 362
            :||||||....||||||..||::...|||||||||.:.||:|    .|...| |.|||||.|.|.
  Rat   211 FLDSHCEVNRVWLEPLLHAIAKDHKMVVCPVIDVIDELTLDY----VGSPIVRGAFDWNLNFRWD 271

  Fly   363 PVPERERKRHNSTAEPVYSPTMAGGLFSIDREFFDRLGTYDSGFDIWGGENLELSFKTWMCGGTL 427
            .|...|.......:.|:.||.|:||:|:|:|.:|:.||.||...|:|||||:|||.:.|||||.|
  Rat   272 DVFSYELDGPEGPSTPIRSPAMSGGIFAINRHYFNELGQYDKDMDLWGGENVELSLRIWMCGGQL 336

  Fly   428 EIVPCSHVGHIFRKRSPYKWRSGVN--VLKKNSVRLAEVWMDEYSQ-YYYHRIGNDKGDWGDVSD 489
            .|:|||.|||..:..|..:.   ||  .|.||.:|:..||:|||.: ::..|........|::||
  Rat   337 FILPCSRVGHNNKALSKNRL---VNQSALSKNLLRVVHVWLDEYKENFFLQRPSLTHVSCGNISD 398

  Fly   490 RRKLRNDLKCKSFKWYLDNIYPELFIPGDSVAHGEIRNLGYGGRTCL 536
            |.:||..|.||||:||||||:|||          |..|.|.|.:..|
  Rat   399 RVELRKRLGCKSFQWYLDNIFPEL----------EPLNRGKGTKPFL 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant9NP_001097342.1 WcaA 207..>478 CDD:223539 132/275 (48%)
pp-GalNAc-T 213..510 CDD:133004 145/301 (48%)
Ricin_B_lectin 521..640 CDD:279046 5/16 (31%)
RICIN 523..642 CDD:238092 5/14 (36%)
Galntl5NP_001020319.1 pp-GalNAc-T 123..419 CDD:133004 145/302 (48%)
Glyco_tranf_2_3 123..355 CDD:290369 117/235 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345976
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.