DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant9 and CG10000

DIOPT Version :9

Sequence 1:NP_001097342.1 Gene:Pgant9 / 246627 FlyBaseID:FBgn0050463 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster


Alignment Length:502 Identity:174/502 - (34%)
Similarity:259/502 - (51%) Gaps:57/502 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 FNQYVSDLISVHRTLPDPRDAWCKDEARYLTNLP---KTDVIICFHNEAWTVLLRTVHSVLDRSP 237
            :|.::|:.:.:.|.||..|...|......|. .|   ...|:|.|||||.::||||:.|:|.|||
  Fly    75 YNIHLSNALGLIRKLPVTRHHSCTTRNSILP-APLEANVSVVISFHNEARSMLLRTIVSLLSRSP 138

  Fly   238 EHLIGKIILVDDYSD-----MPHLKRQLEDYFAAYPKVQI--IRGQKREGLIRARILGANHAKSP 295
            |..:.::|||||.|.     :..|||.:...|.:..::.:  :|.|:|.|||.:|..||:.|...
  Fly   139 EDYLHELILVDDGSQRDVTLLDDLKRWMGGVFGSRYRLGLTFLRNQERMGLIWSRNRGASLASGR 203

  Fly   296 VLTYLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVISDETLEYHYRDSGGVNVGGFDWNLQFS 360
            .:.:||||||..||||||||:|:|.|:...|.|::|.|...||.  ||....:..|||||:|.|.
  Fly   204 YVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLS--YRKGNELLKGGFDWSLHFH 266

  Fly   361 WHPVPERERKRHNSTAEPVYSPTMAGGLFSIDREFFDRLGTYDSGFDIWGGENLELSFKTWMCGG 425
            |   .:|:.....|...|..||..|||:..:.||:|.:||:::....|||||::||:.|.|:|||
  Fly   267 W---LKRQLTNQESLEMPYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWGGESIELAIKLWLCGG 328

  Fly   426 TLEIVPCSHVGHIFRKRSPYKW--------RSGVNVLKKNSVRLAEVWMDEYSQYYY------HR 476
            .:||||||.:|||||:|..:.:        .........||..:||.|:|||...:|      .|
  Fly   329 QIEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKIIAESWLDEYKNMFYALRPAARR 393

  Fly   477 IGNDKGDWGDVSDRRKLRNDLKCKSFKWYLDNIYPELFIPGDSV-AHGEIRNLGYGGRTCLDAPA 540
            |..|.    ...:.:::|.:.:|..|:|||.::.|||.:..|.: |.|.:||    ...|:.  |
  Fly   394 IPLDH----TYDELQRMRKERRCHPFEWYLRHVSPELRMHFDELSATGTLRN----EDRCVH--A 448

  Fly   541 GKKHQKKAVGTYPCHRQGGNQYWMLSKAGEI-RRDDSCLDYA-GKDVTLFGCHGGKG-----NQF 598
            .:|..:..:.:  |:.....|:.||.::|:: ...:.||... |..:.|..|  |:.     :|.
  Fly   449 RQKDSQPILAS--CYLSDITQWSMLRQSGQLSTHRELCLAVGFGMRIALEPC--GRNETVRRSQR 509

  Fly   599 WTYRENTKQLHHGTSGKCLAISESKDKLLMEECSASLSRQ--QWTLE 643
            |. |..| .|.|..|..||. :..||:|.|..|.:....|  |:.||
  Fly   510 WV-RLGT-HLLHAESHLCLD-NPLKDRLEMSTCRSHAVSQSFQFALE 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant9NP_001097342.1 WcaA 207..>478 CDD:223539 118/294 (40%)
pp-GalNAc-T 213..510 CDD:133004 125/317 (39%)
Ricin_B_lectin 521..640 CDD:279046 33/127 (26%)
RICIN 523..642 CDD:238092 33/127 (26%)
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 125/317 (39%)
Ricin_B_lectin 435..548 CDD:279046 33/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.