DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant9 and GALNTL5

DIOPT Version :9

Sequence 1:NP_001097342.1 Gene:Pgant9 / 246627 FlyBaseID:FBgn0050463 Length:650 Species:Drosophila melanogaster
Sequence 2:XP_016867282.1 Gene:GALNTL5 / 168391 HGNCID:21725 Length:496 Species:Homo sapiens


Alignment Length:424 Identity:175/424 - (41%)
Similarity:243/424 - (57%) Gaps:41/424 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 KHKADLQAERMRKKAAEQ--------PK-----KKPQED-SKKVIDPPANFEENPGELGKPVRLP 156
            |.:..|.|....||..:|        ||     |:..|| :|.::....| ..||       .|.
Human    91 KSQEPLSAWSPGKKVHQQIIYGSEQIPKPHVIVKRTDEDKAKSMLGTDFN-HTNP-------ELH 147

  Fly   157 KEMSDEMKKAVDDGWTKNAFNQYVSDLISVHRTLPDPRDAWCKDEARYLTNLPKTDVIICFHNEA 221
            ||:            .|..||..:|..:.:.|.:||.|...|. :..|...||...::|||:||.
Human   148 KEL------------LKYGFNVIISRSLGIEREVPDTRSKMCL-QKHYPARLPTASIVICFYNEE 199

  Fly   222 WTVLLRTVHSVLDRSPEHLIGKIILVDDYSDMPHLKRQLEDYFAAY-PKVQIIRGQKREGLIRAR 285
            ...|.:|:.||.:.:|.:.:.:||||||.|.:..||.:|:.:...: .||:|||.:|||||||||
Human   200 CNALFQTMSSVTNLTPHYFLEEIILVDDMSKVDDLKEKLDYHLETFRGKVKIIRNKKREGLIRAR 264

  Fly   286 ILGANHAKSPVLTYLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVISDETLEYHYRDSGGVNV 350
            ::||:||...||.:||||||....||||||..||::...||||:||||.|.|||  |:.|..|. 
Human   265 LIGASHASGDVLVFLDSHCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLE--YKPSPLVR- 326

  Fly   351 GGFDWNLQFSWHPVPERERKRHNSTAEPVYSPTMAGGLFSIDREFFDRLGTYDSGFDIWGGENLE 415
            |.|||||||.|..|...|......:.:|:.||.|:||:|:|.|.:|:.:|.||...|.||.||||
Human   327 GTFDWNLQFKWDNVFSYEMDGPEGSTKPIRSPAMSGGIFAIRRHYFNEIGQYDKDMDFWGRENLE 391

  Fly   416 LSFKTWMCGGTLEIVPCSHVGHIFRKRSPYKWRSGVNVLKKNSVRLAEVWMDEY-SQYYYHRIGN 479
            ||.:.|||||.|.|:|||.||||.:|::. |..:.::.:..|.:||..||:||| .|::..:.|.
Human   392 LSLRIWMCGGQLFIIPCSRVGHISKKQTG-KPSTIISAMTHNYLRLVHVWLDEYKEQFFLRKPGL 455

  Fly   480 DKGDWGDVSDRRKLRNDLKCKSFKWYLDNIYPEL 513
            ....:|::.:|.:||..|.||||:|||||::|||
Human   456 KYVTYGNIRERVELRKRLGCKSFQWYLDNVFPEL 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant9NP_001097342.1 WcaA 207..>478 CDD:223539 129/272 (47%)
pp-GalNAc-T 213..510 CDD:133004 142/298 (48%)
Ricin_B_lectin 521..640 CDD:279046
RICIN 523..642 CDD:238092
GALNTL5XP_016867282.1 GT2 187..437 CDD:224137 121/253 (48%)
pp-GalNAc-T 190..486 CDD:133004 142/299 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152463
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.