DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30458 and CG13731

DIOPT Version :9

Sequence 1:NP_725663.1 Gene:CG30458 / 246624 FlyBaseID:FBgn0050458 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_730262.3 Gene:CG13731 / 39938 FlyBaseID:FBgn0036717 Length:792 Species:Drosophila melanogaster


Alignment Length:192 Identity:58/192 - (30%)
Similarity:68/192 - (35%) Gaps:77/192 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIIAVAFLACAYADVSE---PAAGGYDYPQP-------------------------------APP 34
            |.:.|..:|.|.||..|   .||.||.||.|                               .||
  Fly     8 LALCVVAVATASADNHERKTRAAEGYFYPPPDVPFDLPVRTTQPPTRPPTRPPTRPPTRPPTRPP 72

  Fly    35 APVKSYIPP------------PPPPPPP---------------APKNTYIPP---PAAPAKAYIP 69
            .|..:|:||            |||||||               .|..||:||   |..|....:|
  Fly    73 TPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLP 137

  Fly    70 PPPP----PPPPAPKN---------TYIPPAPAPVAPVETYIPPAAPAPAYIPPAPVQAEEP 118
            ||||    |||..|..         ||:||...|:.||.|.:||..|.|...||.....:.|
  Fly   138 PPPPSPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTKPP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30458NP_725663.1 GYR 128..145 CDD:128953
CG13731NP_730262.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28KU4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.