DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30458 and CG10953

DIOPT Version :9

Sequence 1:NP_725663.1 Gene:CG30458 / 246624 FlyBaseID:FBgn0050458 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001261042.1 Gene:CG10953 / 36941 FlyBaseID:FBgn0034204 Length:278 Species:Drosophila melanogaster


Alignment Length:280 Identity:98/280 - (35%)
Similarity:109/280 - (38%) Gaps:139/280 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIIAVAFLACAYADVSEPAAGGYDYPQPAP-------------------------------- 33
            ||||::|.|.|||||.|||..   ||||..|||                                
  Fly     1 MKFLVVAFAVLACAYGDVSHL---GYDYSPPAPAPVYQPAPAPVYQPAPAPVYQPAPAPVVIPAP 62

  Fly    34 -------------------PAPVKSYIP----------------------------------PPP 45
                               |||||:|:|                                  |.|
  Fly    63 APAPVVIPAPAPAPVVIPAPAPVKTYVPPAPISIPAPVYQPAPAPIRIPAPVYQPAPAPISIPAP 127

  Fly    46 PP---PPPAPKNTYIPPPAAPAKAYIP-----------------PPPPP---PPPAPKNTYIP-P 86
            .|   |.|||.||||||..|||..|.|                 |.|.|   |.|||....|| |
  Fly   128 APIEIPAPAPVNTYIPPAPAPAPVYQPAPAPIPVSIPAPAPVYQPAPAPVVIPAPAPAPVVIPAP 192

  Fly    87 APAPV-----APVETYIPPA-----APAPAYIP-------PAPVQAEEP----------IIEEIE 124
            |||||     |||::|:|||     ||||.|.|       ||||....|          ::||||
  Fly   193 APAPVVIPAPAPVKSYVPPAPISIPAPAPVYQPAPISIPAPAPVYQPAPAPVYQPTNTQVLEEIE 257

  Fly   125 QPAQDGYRYKTVRRRVFRHR 144
            ..:.||||||||||||:|||
  Fly   258 PASNDGYRYKTVRRRVYRHR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30458NP_725663.1 GYR 128..145 CDD:128953 15/17 (88%)
CG10953NP_001261042.1 FLO_LFY 23..>60 CDD:279962 6/36 (17%)
GYR 261..278 CDD:128953 15/17 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28KU4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014283
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.