DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30458 and CG30457

DIOPT Version :9

Sequence 1:NP_725663.1 Gene:CG30458 / 246624 FlyBaseID:FBgn0050458 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_611198.1 Gene:CG30457 / 36940 FlyBaseID:FBgn0050457 Length:189 Species:Drosophila melanogaster


Alignment Length:194 Identity:93/194 - (47%)
Similarity:104/194 - (53%) Gaps:56/194 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIIAVAFLACAYADVSEPAAGGYDY-----PQPAP------------PAPVKSYIPPPPPP- 47
            ||||::|||.||.|:||||.  ..||:|     |||||            ||||.:||||.|.| 
  Fly     1 MKFLVVAVALLAVAHADVSH--LSGYNYAPVSIPQPAPLPVAAPAPIKVAPAPVNTYIPPAPAPA 63

  Fly    48 ------PPPAPKNTYIPPPA------APAKAYIPPPP-----PPPPPAPKNTYIPPAPAPV---- 91
                  |.|||....||.||      ||...||||.|     |.|.|||   ...|||||:    
  Fly    64 PVQIEVPAPAPAPVAIPAPAPIKVAPAPVNTYIPPAPVQVEIPAPAPAP---VAIPAPAPIKVAP 125

  Fly    92 APVETYIPPA---APAPAYIP--------PAPVQAEEPIIEEIEQPAQDGYRYKTVRRRVFRHR 144
            |||.||||||   .||||.:|        |.||.|.:|::||||..:.|||||||| |||.|.|
  Fly   126 APVNTYIPPAPVSIPAPAPLPVKVAPAPAPVPVLAPQPVLEEIEPVSADGYRYKTV-RRVIRRR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30458NP_725663.1 GYR 128..145 CDD:128953 13/17 (76%)
CG30457NP_611198.1 GYR 173..188 CDD:128953 12/15 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014283
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.