DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc2 and Sepsecs

DIOPT Version :9

Sequence 1:NP_724489.1 Gene:Tdc2 / 246620 FlyBaseID:FBgn0050446 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001121759.1 Gene:Sepsecs / 679383 RGDID:1589491 Length:504 Species:Rattus norvegicus


Alignment Length:473 Identity:97/473 - (20%)
Similarity:157/473 - (33%) Gaps:158/473 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ERRVTPSVEPGYLR----------HL--LPPEAPQEPED-WDQIMRDV----------------- 60
            ||||||:    |:|          ||  |..|..:.||| ||:...::                 
  Rat    10 ERRVTPA----YVRQGCEARRAHEHLIWLLIEQGKCPEDGWDESTLELFLHELAVMDSNNFLGNC 70

  Fly    61 -----EDKIMPGVTHWQHPRF-HAYFPAGNSFPSILGDMLGDGIGCIGFSWAASPACTELETIVL 119
                 |.::...:...:|.|| |                   |||..|...|..|          
  Rat    71 GVGEREGRVASALVARRHYRFIH-------------------GIGRSGDISAVQP---------- 106

  Fly   120 DWLGKAIGLPDHFLALKEGSTGGGVIQT-------SASECVLVTMLAARAQALKRLKAQHPFVEE 177
                ||.|     .:|....|...|:..       |.:.|.:|.|....:..|..|..:|...: 
  Rat   107 ----KAAG-----SSLLNKITNSLVLNVIKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKRPK- 161

  Fly   178 GHLLSKLMAYCSKEAHSCVEKAAMICF---VKLRILEPDDDASLRGQTIYEAMEEDELQGLVPFF 239
                :|.:.:...:..||.:......|   |...:||.|:   ||  |..:|:|. ::|.|.|..
  Rat   162 ----AKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDE---LR--TDLKAVEA-KIQELGPEH 216

  Fly   240 VSTTLGTTGSCAFDNLPEIGKQLQRFPGVWLHVDA------AYAGNSFICPELKPLLKGIEYADS 298
            :.....||...|    |.:..:|:....:..:.|.      ||...|..|..|......:...|.
  Rat   217 ILCLHSTTACFA----PRVPDRLEELAVICANYDIPHVVNNAYGLQSSKCMHLIQQGARVGRIDV 277

  Fly   299 FNTNPNKWLLTNFDCSTLWVRDRIRLTSALVVDPLYLKHGYSDAAIDYRHWGVPLSRRF------ 357
            |..:.:|    ||         .:.:..|::.       |::|:.|.      .:|:.:      
  Rat   278 FVQSLDK----NF---------MVPVGGAIIA-------GFNDSFIQ------EISKMYPGRASA 316

  Fly   358 -RSLKLWFVLRSYGISGLQHYIRHH-----------IKLAKRFEELVLKDKRFEICNQVKLGLVC 410
             .||.:...|.|.|.:|.:..::..           .|||:...|.:||...    |.:.|.:..
  Rat   317 SPSLDVLITLLSLGCNGYKKLLKERKEMFAYLSTQLQKLAEAHNERLLKTPH----NPISLAMTL 377

  Fly   411 FRLKG-SDKLNEKLLSII 427
            ..|.| .|:...:|.|::
  Rat   378 ETLDGHQDRAVTQLGSML 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc2NP_724489.1 Pyridoxal_deC 35..414 CDD:278699 86/448 (19%)
SepsecsNP_001121759.1 selenium_SpcS 13..458 CDD:211833 94/470 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.