DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc2 and SEPSECS

DIOPT Version :9

Sequence 1:NP_724489.1 Gene:Tdc2 / 246620 FlyBaseID:FBgn0050446 Length:637 Species:Drosophila melanogaster
Sequence 2:XP_016863766.1 Gene:SEPSECS / 51091 HGNCID:30605 Length:586 Species:Homo sapiens


Alignment Length:552 Identity:111/552 - (20%)
Similarity:184/552 - (33%) Gaps:194/552 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 GIGCIGFSWAASP--ACTEL-----ETIVLDWLGKAIGLPDHFLALKEGSTGGGVIQTSASECVL 154
            |||..|...|..|  |.:.|     .::|||.: |..|:  |.:|                .|.:
Human   179 GIGRSGDISAVQPKAAGSSLLNKITNSLVLDII-KLAGV--HTVA----------------NCFV 224

  Fly   155 VTMLAARAQALKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKAAMICF---VKLRILEPDDDA 216
            |.|....:..|..|..:|...:     :|.:.:...:..||.:......|   |...:||.|:  
Human   225 VPMATGMSLTLCFLTLRHKRPK-----AKYIIWPRIDQKSCFKSMITAGFEPVVIENVLEGDE-- 282

  Fly   217 SLRGQTIYEAMEEDELQGLVPFFVSTTLGTTGSCAFDNLPEIGKQL------QRFPGVWLHVDAA 275
             ||  |..:|:|. ::|.|.|..:.....|| ||....:|:..::|      ...|.:   |:.|
Human   283 -LR--TDLKAVEA-KVQELGPDCILCIHSTT-SCFAPRVPDRLEELAVICANYDIPHI---VNNA 339

  Fly   276 YAGNSFICPELKPLLKGIEYADSFNTNPNKWLLTNFDCSTLWVRDRIRLTSALVVDPLYLKHGYS 340
            |...|..|..|......:...|:|..:.:|    ||         .:.:..|::.       |::
Human   340 YGVQSSKCMHLIQQGARVGRIDAFVQSLDK----NF---------MVPVGGAIIA-------GFN 384

  Fly   341 DAAIDYRHWGVPLSRRF-------RSLKLWFVLRSYGISGLQHYIRHHIKLAKRFEELVLKDKRF 398
            |:.|.      .:|:.:       .||.:...|.|.|.:|.:       ||.|..:|:      |
Human   385 DSFIQ------EISKMYPGRASASPSLDVLITLLSLGSNGYK-------KLLKERKEM------F 430

  Fly   399 E-ICNQVKLGLVCFRLKGSDKLNEKLLSIINESGKLHMVPASVGDRYIIRFCAVAQNATAEDIDY 462
            . :.||:|        |.|:..||:||                                      
Human   431 SYLSNQIK--------KLSEAYNERLL-------------------------------------- 449

  Fly   463 AWDIIVDFANELLEKEQHDELSEIMNRKKQDTLAQK------RSFFVRMVSDPKIYNPAINKAGT 521
                          ...|:.:|..|..|..|....|      ...|.|.||..::         .
Human   450 --------------HTPHNPISLAMTLKTLDEHRDKAVTQLGSMLFTRQVSGARV---------V 491

  Fly   522 PKLSMELPSPVVSRGSAPIIRTQSSVDHNSWISWPLAFLFNSNNE--EKGSNVSLRFRHLDTNVR 584
            |..||:..|....||         .:.|.:  ::|.|:| |:.:.  .|..:|.|..:.||..::
Human   492 PLGSMQTVSGYTFRG---------FMSHTN--NYPCAYL-NAASAIGMKMQDVDLFIKRLDRCLK 544

  Fly   585 PSSSRRNSGAGSSPSPENELDYVNVQQQQMEQ 616
            .....|        |.|::.:|...:...:|:
Human   545 AVRKER--------SKESDDNYDKTEDVDIEE 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc2NP_724489.1 Pyridoxal_deC 35..414 CDD:278699 74/340 (22%)
SEPSECSXP_016863766.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.