DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc2 and shbg

DIOPT Version :9

Sequence 1:NP_724489.1 Gene:Tdc2 / 246620 FlyBaseID:FBgn0050446 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001007152.1 Gene:shbg / 322604 ZFINID:ZDB-GENE-030131-1324 Length:381 Species:Danio rerio


Alignment Length:176 Identity:41/176 - (23%)
Similarity:60/176 - (34%) Gaps:59/176 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EFRKRGMEMVEYICNYLE-------TLNERRVTPSVEPGYLRHLLPPEA---PQEPEDWDQIMRD 59
            |.|..|..:|..:.|.:|       .|.|.::|..:.......|:..:.   |.||| .|..:|.
Zfish   123 ELRSEGKFVVLEVNNEVELVVGLHSKLAEEQLTGKIRLALGGMLVDKQKLFHPFEPE-MDACIRG 186

  Fly    60 VEDKIMPGVTHWQH------------PR-FHAYFPAGNSFPSILGDMLGDGIGCIGFSWAASPAC 111
                     .||.:            || ..:....|:.||         |.|...|:.:..||.
Zfish   187 ---------GHWLNLSTPWDTDSTWEPRPCSSEIKKGSYFP---------GTGVAVFNTSDLPAL 233

  Fly   112 -TELETIVLD----WLGKAIGL------------PDHFLALKEGST 140
             ||...|.::    |:|..:.|            .|..|.||:|||
Zfish   234 KTEEAGITVEIFGSWIGTTLSLQSTGFLYVLEGDKDDKLGLKDGST 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc2NP_724489.1 Pyridoxal_deC 35..414 CDD:278699 32/139 (23%)
shbgNP_001007152.1 LamG 65..191 CDD:304605 18/77 (23%)
LamG 214..349 CDD:304605 21/75 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578198
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.