DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc2 and GAD2

DIOPT Version :9

Sequence 1:NP_724489.1 Gene:Tdc2 / 246620 FlyBaseID:FBgn0050446 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_000809.1 Gene:GAD2 / 2572 HGNCID:4093 Length:585 Species:Homo sapiens


Alignment Length:496 Identity:115/496 - (23%)
Similarity:212/496 - (42%) Gaps:62/496 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MVEYICNYLETLNERRVTPSVEPGYLRHLLPP---EAPQEPEDWDQIMRDVEDKIMPGVTHWQHP 74
            :::|:....:     |.|..::..|...||..   |...:|::.::|:...:..:...: ...||
Human   118 LLQYVVKSFD-----RSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAI-KTGHP 176

  Fly    75 RFHAYFPAGNSFPSILGDMLGDGIGCIGFSWAASPACTELETIVLDWLGKAIGLPDHFLALKEGS 139
            |:......|.....:..|.|........|::..:|....||.:.|..:.:.||.|        |.
Human   177 RYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWP--------GG 233

  Fly   140 TGGGVIQTSASECVLVTMLAARAQALKRLKAQHPFVEEG-HLLSKLMAYCSKEAHSCVEKAAMIC 203
            :|.|:.....:...:..|:.||.:....:|      |:| ..|.:|:|:.|:.:|..::|.|...
Human   234 SGDGIFSPGGAISNMYAMMIARFKMFPEVK------EKGMAALPRLIAFTSEHSHFSLKKGAAAL 292

  Fly   204 FV---KLRILEPDDDASLRGQTIYEAME----EDELQGLVPFFVSTTLGTTGSCAFDNLPEIGKQ 261
            .:   .:.:::.|:    ||:.|...:|    |.:.:|.|||.||.|.|||...|||.|..:...
Human   293 GIGTDSVILIKCDE----RGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADI 353

  Fly   262 LQRFPGVWLHVDAAYAGNSFICPELKPLLKGIEYADSFNTNPNKWLLTNFDCSTLWVRDRIRLTS 326
            .:::. :|:|||||:.|...:..:.|..|.|:|.|:|...||:|.:.....||.|.||:...:.:
Human   354 CKKYK-IWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQN 417

  Fly   327 ALVVDPLYL----KHGYSDAAIDYRHWGVPLSRRFRSLKLWFVLRSYGISGLQHYIRHHIKLAKR 387
            ...:...||    ||  .|.:.|.....:...|.....|||.:.|:.|.:|.:.::...::||:.
Human   418 CNQMHASYLFQQDKH--YDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEY 480

  Fly   388 FEELVLKDKRFEIC--NQVKLGLVCF---------------RLKGSDKLNEKLLSIINESGKLHM 435
            ...::...:.:|:.  .:.:...|||               |:....|:...:.:.:.|.|...:
Human   481 LYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEYGTTMV 545

  Fly   436 VPASVGDRYIIRFCAVAQN--ATAEDIDYAWDIIVDFANEL 474
            ....:||: :..|..|..|  ||.:|||:..:.|.....:|
Human   546 SYQPLGDK-VNFFRMVISNPAATHQDIDFLIEEIERLGQDL 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc2NP_724489.1 Pyridoxal_deC 35..414 CDD:278699 97/410 (24%)
GAD2NP_000809.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Pyridoxal_deC 138..509 CDD:278699 95/392 (24%)
Substrate binding 181..183 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144950
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.