DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc2 and GAD1

DIOPT Version :9

Sequence 1:NP_724489.1 Gene:Tdc2 / 246620 FlyBaseID:FBgn0050446 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_000808.2 Gene:GAD1 / 2571 HGNCID:4092 Length:594 Species:Homo sapiens


Alignment Length:503 Identity:119/503 - (23%)
Similarity:215/503 - (42%) Gaps:65/503 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MEMVEYICNYLETLNERRVTPSVEPGYLRHLLPP------EAPQEPEDWDQIMRDVEDKIMPGVT 69
            :|:|:.:.||:....:|. |..::..:...||..      |....||..:||:.|..|.:..|| 
Human   118 LEVVDILLNYVRKTFDRS-TKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV- 180

  Fly    70 HWQHPRFHAYFPAGNSFPSILGDMLGDGIGCIGFSWAASPACTELETIVLDWLGKAIGLPDHFLA 134
            ...||||......|.....:.|:.|........|::..:|....:|.|.|..:.:.:|.      
Human   181 RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGW------ 239

  Fly   135 LKEGSTGGGVIQTSASECVLVTMLAARAQALKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKA 199
              ....|.|:.....:...:.:::|||.:....:|.:....     :.||:.:.|:::|..::||
Human   240 --SSKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAA-----VPKLVLFTSEQSHYSIKKA 297

  Fly   200 A------------MICFVKLRILEPDDDASLRGQTIYEAMEEDELQGLVPFFVSTTLGTTGSCAF 252
            .            :.|..:.:|:..|.:|.     |.||.:    :|.|||:|:.|.|||...||
Human   298 GAALGFGTDNVILIKCNERGKIIPADFEAK-----ILEAKQ----KGYVPFYVNATAGTTVYGAF 353

  Fly   253 DNLPEIGKQLQRFPGVWLHVDAAYAGNSFICPELKPLLKGIEYADSFNTNPNKWLLTNFDCSTLW 317
            |.:.||....::: .:|||||||:.|...:..:.:..|.|||.|:|...||:|.:.....||.:.
Human   354 DPIQEIADICEKY-NLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAIL 417

  Fly   318 VRDR--IRLTSALVVDPLYLKHGYSDAAIDYRHWGVPLSRRFRSLKLWFVLRSYGISGLQHYIRH 380
            |:::  ::..:.:....|:......|.:.|.....:...|.....|.|.:.::.|..|.::.|..
Human   418 VKEKGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINK 482

  Fly   381 HIKLAKRFEELVLKDKRFEIC--NQVKLGLVCF-----RLKG-------SDKLNE---KLLSIIN 428
            .::||:.....:...:.||:.  .:.:...|||     .|:|       .:||::   |:.:::.
Human   483 CLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGVPDSPQRREKLHKVAPKIKALMM 547

  Fly   429 ESGKLHMVPASVGDRYIIRFCAVAQN--ATAEDIDYAWDIIVDFANEL 474
            |||...:.....||:... |..|..|  ||..|||:..:.|.....:|
Human   548 ESGTTMVGYQPQGDKANF-FRMVISNPAATQSDIDFLIEEIERLGQDL 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc2NP_724489.1 Pyridoxal_deC 35..414 CDD:278699 93/405 (23%)
GAD1NP_000808.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Pyridoxal_deC 144..518 CDD:365998 93/397 (23%)
Substrate binding 190..192 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144951
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.