DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc2 and Gad1

DIOPT Version :9

Sequence 1:NP_724489.1 Gene:Tdc2 / 246620 FlyBaseID:FBgn0050446 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_058703.1 Gene:Gad1 / 24379 RGDID:2652 Length:593 Species:Rattus norvegicus


Alignment Length:503 Identity:118/503 - (23%)
Similarity:212/503 - (42%) Gaps:65/503 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MEMVEYICNYLETLNERRVTPSVEPGYLRHLLPP------EAPQEPEDWDQIMRDVEDKIMPGVT 69
            :|:|:.:.||:....:|. |..::..:...||..      |....||..:||:.|..|.:..|| 
  Rat   117 LEVVDILLNYVRKTFDRS-TKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV- 179

  Fly    70 HWQHPRFHAYFPAGNSFPSILGDMLGDGIGCIGFSWAASPACTELETIVLDWLGKAIGLPDHFLA 134
            ...||||......|.....:.|:.|........|::..:|....:|.|.|..:.:.||.      
  Rat   180 RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIIGW------ 238

  Fly   135 LKEGSTGGGVIQTSASECVLVTMLAARAQALKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKA 199
              ....|.|:.....:...:.:::|||.:....:|.:....     :.||:.:.|:.:|..::||
  Rat   239 --SNKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAA-----VPKLVLFTSEHSHYSIKKA 296

  Fly   200 A------------MICFVKLRILEPDDDASLRGQTIYEAMEEDELQGLVPFFVSTTLGTTGSCAF 252
            .            :.|..:.:|:..|.:|.     |.:|.:    :|.||.:|:.|.|||...||
  Rat   297 GAALGFGTDNVILIKCNERGKIIPADLEAK-----ILDAKQ----KGFVPLYVNATAGTTVYGAF 352

  Fly   253 DNLPEIGKQLQRFPGVWLHVDAAYAGNSFICPELKPLLKGIEYADSFNTNPNKWLLTNFDCSTLW 317
            |.:.||....::: .:|||||||:.|...:..:.:..|.|||.|:|...||:|.:.....||.:.
  Rat   353 DPIQEIADICEKY-NLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAIL 416

  Fly   318 VRDR--IRLTSALVVDPLYLKHGYSDAAIDYRHWGVPLSRRFRSLKLWFVLRSYGISGLQHYIRH 380
            |:::  ::..:.:....|:......|.:.|.....:...|.....|.|.:.::.|..|.::.|..
  Rat   417 VKEKGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINK 481

  Fly   381 HIKLAKRFEELVLKDKRFEIC--NQVKLGLVCF-----RLKG-------SDKLNE---KLLSIIN 428
            .::||:.....:...:.||:.  .:.:...|||     .|:|       .:||:.   |:.:::.
  Rat   482 CLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAPKIKALMM 546

  Fly   429 ESGKLHMVPASVGDRYIIRFCAVAQN--ATAEDIDYAWDIIVDFANEL 474
            |||...:.....||:... |..|..|  ||..|||:..:.|.....:|
  Rat   547 ESGTTMVGYQPQGDKANF-FRMVISNPAATQSDIDFLIEEIERLGQDL 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc2NP_724489.1 Pyridoxal_deC 35..414 CDD:278699 92/405 (23%)
Gad1NP_058703.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Pyridoxal_deC 143..517 CDD:395219 92/397 (23%)
Substrate binding. /evidence=ECO:0000250 189..191 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338646
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.