DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc2 and Sgpl1

DIOPT Version :9

Sequence 1:NP_724489.1 Gene:Tdc2 / 246620 FlyBaseID:FBgn0050446 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001303602.1 Gene:Sgpl1 / 20397 MGIID:1261415 Length:568 Species:Mus musculus


Alignment Length:502 Identity:97/502 - (19%)
Similarity:167/502 - (33%) Gaps:162/502 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 GFSWAASPACTELETIVLDWLGKAIG--------LPDHFLALKE---------------GSTGGG 143
            |..:...|..|||       |.:|.|        .||.|..|::               |....|
Mouse   147 GAVYNGEPKLTEL-------LVQAYGEFTWSNPLHPDIFPGLRKLEAEIVRMTCSLFNGGPDSCG 204

  Fly   144 VIQTSASECVLVTMLAARAQALKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKAAMICFVKL- 207
            .:.:..:|.:|:...|.|..||          |:|....:::|  .:.||:..:|||....:|: 
Mouse   205 CVTSGGTESILMACKAYRDLAL----------EKGIKTPEIVA--PESAHAAFDKAAHYFGMKIV 257

  Fly   208 -----RILEPDDDASLRGQTIYEAMEEDELQGLVPFFVSTTLGTTGSCAFDNLPEIGKQLQRFPG 267
                 :.:|.|..|..|..:...||          ...||.....|  ..|.:||:.|...|:. 
Mouse   258 RVALKKNMEVDVQAMKRAISRNTAM----------LVCSTPQFPHG--VMDPVPEVAKLAVRYK- 309

  Fly   268 VWLHVDAAYAGNSFICPELK--PLLKGIEYADSFNTNPNKWLLTNFDCSTLWVRDRIRLTSALVV 330
            :.|||||...|...:..|..  ||.|..::                         |::..:::..
Mouse   310 IPLHVDACLGGFLIVFMEKAGYPLEKPFDF-------------------------RVKGVTSISA 349

  Fly   331 DPLYLKHGYS---DAAIDYRH-------------W--GVPLSRRFRSLK-------LWFVLRSYG 370
            |.  .|:||:   .:.:.|.:             |  ||..|......:       .|..|..:|
Mouse   350 DT--HKYGYAPKGSSVVMYSNEKYRTYQFFVGADWQGGVYASPSIAGSRPGGIIAACWAALMHFG 412

  Fly   371 ISGLQHYIRHHIKLAKRFEELVLKDKRFEICNQVKLGLVCFRLKGSDKLN-EKLLSIINESG--- 431
            .:|.....:..||.|:..:..:...|...|....:|.::..   ||:..: .:|.::::..|   
Mouse   413 ENGYVEATKQIIKTARFLKSELENIKNIFIFGDPQLSVIAL---GSNDFDIYRLSNMMSAKGWNF 474

  Fly   432 KLHMVPASVGDRYIIRFCAVAQNATAEDIDYAWDIIVDFANELLEKEQHDELSEIMNRKKQDT-- 494
            .....|.|      |.||....:....       :.:.|..::.|     .:::||...|..|  
Mouse   475 NYLQFPRS------IHFCITLVHTRKR-------VAIQFLKDIRE-----SVTQIMKNPKAKTTG 521

  Fly   495 ----------------LAQKRSFFVRMV--SDPKIYNPAINKAGTPK 523
                            :|:..|.|:..:  :||......:|  |:||
Mouse   522 MGAIYGMAQATIDRKLVAEISSVFLDCLYTTDPVTQGNQMN--GSPK 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc2NP_724489.1 Pyridoxal_deC 35..414 CDD:278699 73/367 (20%)
Sgpl1NP_001303602.1 DOPA_deC_like 146..507 CDD:99743 84/439 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.