DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc2 and spl-3

DIOPT Version :9

Sequence 1:NP_724489.1 Gene:Tdc2 / 246620 FlyBaseID:FBgn0050446 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_500051.2 Gene:spl-3 / 190868 WormBaseID:WBGene00022427 Length:606 Species:Caenorhabditis elegans


Alignment Length:215 Identity:48/215 - (22%)
Similarity:87/215 - (40%) Gaps:50/215 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GSTGGGVIQTSASECVLVTMLAARAQALKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKAAM- 201
            |....||:....:|.:::..||.|.::..|          |...::::|  ...||..::|||. 
 Worm   194 GKDSCGVVAGGGTEALMLACLAYRNRSRAR----------GEWRAEIVA--PSTAHPALDKAAAF 246

  Fly   202 --ICFVKLRILEPDDDASLRGQTIYEAMEEDELQGLVPFFVSTTLGTTGSCAFDNLPEIGKQLQR 264
              :...::::.|.||.|::      .||:............|.....||:  .|.:.::.|..||
 Worm   247 FDMTIKRIQVSETDDRANV------GAMKRAIGPRTCMIIASAPNHITGT--VDPIEKLAKLAQR 303

  Fly   265 FPGVWLHVDAAYAGNSFICPELKPLLKGIEYAD----SFN------TNPNKWLLTNFDCSTLWVR 319
            : .:.||||....|  |:.|.:       ||||    :|:      |:.:..|.....|..    
 Worm   304 Y-HIPLHVDCTLGG--FVLPFM-------EYADYSVPAFDFRLPGVTSISADLHRYGQCPG---- 354

  Fly   320 DRIRLTSALVVDPLYLKHGY 339
               ||:..:..:|.:|:|.:
 Worm   355 ---RLSVLMYREPAFLRHQF 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc2NP_724489.1 Pyridoxal_deC 35..414 CDD:278699 48/215 (22%)
spl-3NP_500051.2 DOPA_deC_like 147..502 CDD:99743 48/215 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.