DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc2 and spl-2

DIOPT Version :9

Sequence 1:NP_724489.1 Gene:Tdc2 / 246620 FlyBaseID:FBgn0050446 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_505372.1 Gene:spl-2 / 181859 WormBaseID:WBGene00006418 Length:542 Species:Caenorhabditis elegans


Alignment Length:316 Identity:70/316 - (22%)
Similarity:108/316 - (34%) Gaps:105/316 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PGYLRHLLPPEAPQEPEDWDQIMRDVEDKIMPGVTHWQHPRFHAYFPAGNSFPSILGDMLGDGIG 99
            |.:|...:........:|.|:  |::.:::. |...|.:|.:...||......:.:..|      
 Worm   124 PAFLEGRVSGAVFNREDDKDE--REMYEEVF-GKFAWTNPLWPKLFPGVRIMEAEVVRM------ 179

  Fly   100 CIGFSWAASPACTELETIVLDWLGKAIGLPDHFLALKEGSTGGGVIQTSASECVLVTMLAARAQA 164
            |.......|..|..:                        ||||.:       .:|:..||.|.:.
 Worm   180 CCNMMNGDSETCGTM------------------------STGGSI-------SILLACLAHRNRL 213

  Fly   165 LKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKAAMICF-VKLRILEPDD----------DASL 218
            |||          |...::::...|  .|:...|||. || :|:|.:..|.          .|::
 Worm   214 LKR----------GEKYTEMIVPSS--VHAAFFKAAE-CFRIKVRKIPVDPVTFKVDLVKMKAAI 265

  Fly   219 RGQTIYEAMEEDELQGLVPFFVSTTLGTTGSCAFDNLPEIGKQLQRFPGVWLHVDAAYAGNSFIC 283
            ..:|..       |.|..|.|   ..||.     |::..|| ||.....:.:||||...|  |:.
 Worm   266 NKRTCM-------LVGSAPNF---PFGTV-----DDIEAIG-QLGLEYDIPVHVDACLGG--FLL 312

  Fly   284 PELK----------PLLKGIEYADS--FNTNP---------NKWLLTN-FDCSTLW 317
            |.|:          |.:..|. |||  :...|         ||.||.| :.|...|
 Worm   313 PFLEEDEIRYDFRVPGVSSIS-ADSHKYGLAPKGSSVVLYRNKELLHNQYFCDADW 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc2NP_724489.1 Pyridoxal_deC 35..414 CDD:278699 70/316 (22%)
spl-2NP_505372.1 DOPA_deC_like 130..493 CDD:99743 68/310 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.