DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tdc2 and sgpl1

DIOPT Version :9

Sequence 1:NP_724489.1 Gene:Tdc2 / 246620 FlyBaseID:FBgn0050446 Length:637 Species:Drosophila melanogaster
Sequence 2:XP_005156777.1 Gene:sgpl1 / 100037312 ZFINID:ZDB-GENE-070410-24 Length:574 Species:Danio rerio


Alignment Length:184 Identity:42/184 - (22%)
Similarity:71/184 - (38%) Gaps:43/184 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GSTGGGVIQTSASECVLVTMLAARAQALKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKAAMI 202
            |....|.:.:..:|.:|:...|.|..|.:| ..:||         :::|..|  .|:..:|||..
Zfish   197 GPDSCGTVTSGGTESILMACKAYRDMAHER-GIKHP---------EIIAPIS--VHAAFDKAAHY 249

  Fly   203 CFVKL-------RILEPDDDASLRGQTIYEAMEEDELQGLVPFFVSTTLGTTGSCAFDNLPEIGK 260
            ..:||       :.::.|..|..|..|...||    |....|.|....:        |.:.|:.|
Zfish   250 FGMKLIHVPLDNKTMKVDVKAMRRAITKNTAM----LVCSAPQFPHGIM--------DPVEEVAK 302

  Fly   261 QLQRFPGVWLHVDAAYAGNSFICPE-----LKPL---LKGIEYADSFNTNPNKW 306
            ...:: .:..||||...|...:..|     |.|.   :||:   .|.:.:.:|:
Zfish   303 LAVKY-NIPFHVDACLGGFLIVFMEKAGFKLAPFDFRVKGV---TSISADTHKY 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tdc2NP_724489.1 Pyridoxal_deC 35..414 CDD:278699 42/184 (23%)
sgpl1XP_005156777.1 DOPA_deC_like 143..504 CDD:99743 42/184 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.