DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and ZNF765

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001035275.1 Gene:ZNF765 / 91661 HGNCID:25092 Length:523 Species:Homo sapiens


Alignment Length:306 Identity:85/306 - (27%)
Similarity:135/306 - (44%) Gaps:70/306 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 CGICNTVFSSEKFLKFHMRIHENRAPKSIQDALPIGAHQQYSELDQFYCEICNKSFDET-LLTVH 241
            |.||..||:|::::..|.|.|....|                    :.|..|.|:|.:| .||.|
Human   245 CDICGKVFNSKRYVARHRRCHTGEKP--------------------YKCNECGKTFSQTYYLTCH 289

  Fly   242 KQMHQQESSEIMCSICNRKFENEVTYQMHQKIH--EKPRDSESSRKLAQRTSLDKEKPGFPCQYC 304
            :::|..| ....|..|::.|..:...|:|::||  |||                     :.|..|
Human   290 RRLHTGE-KPYKCEECDKAFHFKSKLQIHRRIHTGEKP---------------------YKCNEC 332

  Fly   305 ERVFTRPFEKVKHERVHTGEKPYACEVCGKTFRVSYSLTLHLRTHTNIRPYVCTVCNKRFKSHQV 369
            .:.|::......|.|:|||||||.|..|||||......|.|.|.||..:||.|..|:|.|.....
Human   333 GKTFSQKSYLTCHRRLHTGEKPYKCNECGKTFSRKSHFTCHHRVHTGEKPYKCNECSKTFSHKSS 397

  Fly   370 YSHHLRIHSSERQFSCDACPKTFRTSVQL-YAHKNTHTKPYRCAVCNRPFSSMYAVKNHMQTHKE 433
            .::|.|:|:.|:.:.|:.|.|||...:.| ....::..|||:|..|::    .|:.|::::.|::
Human   398 LTYHRRLHTEEKPYKCNECGKTFNQQLTLNICRLHSGEKPYKCEECDK----AYSFKSNLEIHQK 458

  Fly   434 ISSKGSVGSGTPNIKSAATSKSQAAGKFYCNTCGAEYARLFALRLH 479
            |.::                    ...:.||.||..::|..:|..|
Human   459 IHTE--------------------ENPYKCNECGKTFSRTSSLTYH 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
zf-H2C2_2 316..336 CDD:290200 13/19 (68%)
C2H2 Zn finger 329..349 CDD:275368 9/19 (47%)
zf-H2C2_2 341..366 CDD:290200 11/24 (46%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 385..405 CDD:275368 6/20 (30%)
C2H2 Zn finger 411..431 CDD:275368 4/19 (21%)
ZNF765NP_001035275.1 KRAB 8..>48 CDD:214630
KRAB 8..47 CDD:279668
C2H2 Zn finger 217..237 CDD:275368
zf-H2C2_2 230..254 CDD:290200 5/8 (63%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 260..282 CDD:290200 8/41 (20%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 285..309 CDD:290200 7/24 (29%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
zf-H2C2_2 314..338 CDD:290200 10/44 (23%)
COG5048 <325..477 CDD:227381 54/196 (28%)
C2H2 Zn finger 329..349 CDD:275368 5/19 (26%)
zf-H2C2_2 341..366 CDD:290200 15/24 (63%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
zf-H2C2_2 397..422 CDD:290200 9/24 (38%)
C2H2 Zn finger 440..460 CDD:275368 5/23 (22%)
zf-H2C2_2 452..477 CDD:290200 6/44 (14%)
C2H2 Zn finger 468..488 CDD:275368 7/17 (41%)
C2H2 Zn finger 496..515 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.