DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and ZNF468

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_016882932.1 Gene:ZNF468 / 90333 HGNCID:33105 Length:541 Species:Homo sapiens


Alignment Length:275 Identity:87/275 - (31%)
Similarity:130/275 - (47%) Gaps:23/275 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 CGICNTVFSSEKFLKFHMRIHENRAPKSIQDALPIGAHQQ--------YSELDQFYCEICNKSFD 234
            |.:|..||:.:::|..|.|.|....|....:......|..        ::....:.||.|:|.|.
Human   264 CDVCGKVFNQKRYLACHRRCHTGEKPYKCNECGKTFGHNSSLFIHKALHTGEKPYECEECDKVFS 328

  Fly   235 -ETLLTVHKQMHQQESSEIMCSICNRKFENEVTYQMHQKIH--EKPRDSESSRKLAQRTSL---- 292
             ::.|..||::|..| ....|.:|:..|........|..:|  |||.......|:..|.|.    
Human   329 RKSHLERHKRIHTGE-KPYKCKVCDEAFAYNSYLAKHTILHTGEKPYTCNECGKVFNRLSTLARH 392

  Fly   293 ----DKEKPGFPCQYCERVFTRPFEKVKHERVHTGEKPYACEVCGKTFRVSYSLTLHLRTHTNIR 353
                ..||| :.|:.|::||:|.....:|.|:|:|||||.||.|.|.|....:|..|.|.||..:
Human   393 HRLHTGEKP-YKCEECDKVFSRKSHLERHRRIHSGEKPYKCEECCKVFSRKSNLERHRRIHTGEK 456

  Fly   354 PYVCTVCNKRFKSHQVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAHKNTHT--KPYRCAVCNR 416
            ||.|.||:|.|:.....:.|.|:|:.|:.:.|:.|.|||..:..|..|:..||  |||:|..|.:
Human   457 PYKCKVCDKAFQRDSHLAQHQRVHTGEKPYKCNECGKTFGQTSSLIIHRRLHTGEKPYKCNECGK 521

  Fly   417 PFSSMYAVKNHMQTH 431
            .||.|.::..|.:.|
Human   522 TFSQMSSLVYHHRLH 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 4/19 (21%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
zf-H2C2_2 316..336 CDD:290200 12/19 (63%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 341..366 CDD:290200 12/24 (50%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
C2H2 Zn finger 411..431 CDD:275368 6/19 (32%)
ZNF468XP_016882932.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.