DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and YY1

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_849323.1 Gene:YY1 / 826093 AraportID:AT4G06634 Length:387 Species:Arabidopsis thaliana


Alignment Length:263 Identity:70/263 - (26%)
Similarity:102/263 - (38%) Gaps:49/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 VTYQMHQKIHEKPRDSESSRKLAQRTSLDKEKPGFPCQY--CERVFTRPFEKVKHERVHTGEKPY 327
            ||.....::.||.::.:......:.|:    :..|.|.|  |.:.|.......||..:| ||:.|
plant    49 VTEDTFSRLKEKEKEPDVPEPEPEPTT----EILFLCSYDGCGKTFFDVSALRKHSHIH-GERQY 108

  Fly   328 AC--EVCGKTFRVSYSLTLHLRTHTNIRPYVCTV--CNKRFKSHQVYSHHLRIHSSERQFSCDAC 388
            .|  |.|||.|..|..|..|...||..|.|:||.  |.|.|........|::.||.|        
plant   109 VCDQEGCGKKFLDSSKLKRHYLIHTGERNYICTYEGCGKAFSLDFNLRSHMKTHSQE-------- 165

  Fly   389 PKTFRTSVQLYAHKNTHTKPYRCAVCNRPFSSMYAVKNHMQTHKEISSKGSVGSGTP-------N 446
                          |.|..||  :.|.:.::..|.:|||:..:.|.:..|.....||       .
plant   166 --------------NYHICPY--SGCVKRYAHEYKLKNHVAAYHEKNGGGETPKYTPPAEKVLRT 214

  Fly   447 IKSAATSKSQAAGKFYC---NTCGAEYARLFALRLHMKSAHGLVEEQENPATSTDAAHVA----E 504
            :|:.||....::.:.|.   ..|...|...:.|:||:|..|....::||..|.|...|..    |
plant   215 VKTPATVCGPSSDRPYACPYEGCEKAYIHEYKLKLHLKREHPGHLQEENADTPTLNKHNGNDRNE 279

  Fly   505 TDD 507
            .||
plant   280 IDD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 2/8 (25%)
C2H2 Zn finger 301..321 CDD:275368 6/21 (29%)
zf-H2C2_2 316..336 CDD:290200 11/21 (52%)
C2H2 Zn finger 329..349 CDD:275368 9/21 (43%)
zf-H2C2_2 341..366 CDD:290200 11/26 (42%)
C2H2 Zn finger 357..377 CDD:275368 6/21 (29%)
C2H2 Zn finger 385..405 CDD:275368 1/19 (5%)
C2H2 Zn finger 411..431 CDD:275368 5/19 (26%)
YY1NP_849323.1 C2H2 Zn finger 84..103 CDD:275368 4/18 (22%)
COG5048 <92..170 CDD:227381 30/100 (30%)
C2H2 Zn finger 110..132 CDD:275368 9/21 (43%)
C2H2 Zn finger 140..162 CDD:275368 6/21 (29%)
C2H2 Zn finger 170..189 CDD:275368 6/20 (30%)
SFP1 <196..274 CDD:227516 19/77 (25%)
C2H2 Zn finger 232..252 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.