DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and AT3G29340

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_189580.1 Gene:AT3G29340 / 822592 AraportID:AT3G29340 Length:650 Species:Arabidopsis thaliana


Alignment Length:651 Identity:120/651 - (18%)
Similarity:183/651 - (28%) Gaps:284/651 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CESCGNVYEDTES---YDRAHGPQAGCCTGASGELDFIEEVAEDCISEEVGEEDIVYADVPLWEL 94
            |:.||..:|..::   :.|.|.|                      |.|::.::          |.
plant    45 CKICGKSFECYQALGGHQRIHRP----------------------IKEKLSKQ----------EF 77

  Fly    95 VEEVPANVKAEKDQNEPSNSDRYFCYDCHSIFENRNKAEEHICPRAESGGSSQQDGDAKAPVRRK 159
            .|..|...|.:|  ...|:|..|.|..|..||.         |.|. .||.::.....|    |:
plant    78 SEVYPRKSKLQK--RPESSSSCYECKVCGKIFG---------CYRG-LGGHTKLHRSTK----RE 126

  Fly   160 LASVSARTGPRDAS---SVISCGICNTVFSSEKFLKFHMRIHENRAPKSIQDALPIGAHQQYSEL 221
            |||........|:|   .::|......|...||||.......:...|.|...|||.....:....
plant   127 LASTQDENSLLDSSEAKKIVSQPSSFKVSQEEKFLHCVELKQDFSEPLSHSGALPSTLRSKLQTK 191

  Fly   222 DQF----YCEICNKSF-DETLLTVHKQMHQQESSEIMCSICNRKFENEVTYQ------MHQKIHE 275
            .|:    :|:||.||| ....|..||::|::.|.::   .|.||:..:  |.      ..:||.:
plant   192 TQWKSSCHCKICGKSFVCSQGLGNHKRVHREISGKL---ACKRKYTED--YNPFSDSLKAKKIVK 251

  Fly   276 KPRDSESSR---------------KLAQRTSLDKEKPGFPCQYCERV--FTRPFEKVKHER---- 319
            ||...|.|:               :|...:..||   ...|....:|  ..|..||.:...    
plant   252 KPSSFEVSQEEKILHCVELKQDFGELLAHSGFDK---SISCSKSIKVKKVARKNEKTEDSTSLFG 313

  Fly   320 VHTGE---KPYACEVCGKTFRVSYSLTLHLRTHT------------------------------- 350
            |..||   :.:.|:.||:.|.....:..|.|.|:                               
plant   314 VFVGEMSQRLHGCKTCGRKFGTLKGVYGHQRMHSGNHNRIEDENGLERIWGLKKKSRVCSVSAFD 378

  Fly   351 ------------------------------------------------NIRP------------- 354
                                                            .::|             
plant   379 RFKGSSFMAEIEKHEVIEAALNLVMLCQGVYDFASISNLPLGDGFMDLELKPCPLRRKLQKKSRS 443

  Fly   355 -YVCTVCNKRFKSHQVYSHHLRIH------------------------------------SSERQ 382
             |.|::|.|.|...|....|.|:|                                    ..|:.
plant   444 SYKCSICEKSFVCSQALGSHQRLHRWKLVPKPEYIEDDSSLLDSSEAKKIVSKPSSFEHAQEEKI 508

  Fly   383 FSC-------------------DAC--------------------PKTFRTSVQ---LY------ 399
            ..|                   |.|                    |.:|..||.   ||      
plant   509 LQCVEPKLEFHEQLAHSGFDKFDTCSKIRFSALPSPPEAKKIVSQPPSFEVSVDEKILYRAEPKL 573

  Fly   400 ------AHK-NTHTKPYRCAVCNRPFSSMYAVKNHMQTHKEISSKGSVGSGTPNIKSAATSKSQA 457
                  ||. ..::..||..:|.:.|....|:..|...|:.|  ||.: :||.:..|.:.:.|:|
plant   574 NFSEPLAHSCFDNSSSYRSIICGKSFVCSQALGGHQTLHRSI--KGQL-AGTEDGNSLSVTDSEA 635

  Fly   458 A 458
            :
plant   636 S 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/25 (20%)
C2H2 Zn finger 301..321 CDD:275368 5/25 (20%)
zf-H2C2_2 316..336 CDD:290200 6/26 (23%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 341..366 CDD:290200 9/117 (8%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..405 CDD:275368 11/74 (15%)
C2H2 Zn finger 411..431 CDD:275368 4/19 (21%)
AT3G29340NP_189580.1 zf-C2H2_6 43..68 CDD:290623 7/44 (16%)
C2H2 Zn finger 45..65 CDD:275368 5/19 (26%)
C2H2 Zn finger 100..120 CDD:275368 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2696
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.