DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and Prdm4

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_857633.2 Gene:Prdm4 / 72843 MGIID:1920093 Length:803 Species:Mus musculus


Alignment Length:507 Identity:111/507 - (21%)
Similarity:170/507 - (33%) Gaps:155/507 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSNQAEETTPNLHVEDGDLSGGALQQEF-LYCESCGNVYEDTESYDRAHGP-------------- 52
            ||:.......:|.:||.:.:...:...| ::|..|...| .::..|  |||              
Mouse   342 SSDSLSFVPSSLQMEDSNSNKENMATLFTIWCTLCDRAY-PSDCPD--HGPVTFVPDTPIESRAR 403

  Fly    53 ----------QAGCCTGASGELDFI-----EEV-AEDCISEEVGE-----EDIVYADVP---LWE 93
                      |:...|...|.|..|     |.: ...|....:|:     |...:.|..   :|:
Mouse   404 LSLPKQLVLRQSIVGTDVVGVLPLIGVWTAETIPVRTCFGPLIGQQSHSLEVAEWTDKAVNHVWK 468

  Fly    94 L------------VEEVPAN----VKAEKDQNE------PSNSDRYFCYDCHSIFENRNKAEEHI 136
            :            .:|...|    |:..:::.|      |.:...|||            ..:.|
Mouse   469 IYHTGVLEFCIITTDENECNWMMFVRKARNREEQNLVAYPHDGKIYFC------------TSQDI 521

  Fly   137 CPRAE-----SGGSSQQDGDAKAPVRRKLASVSARTGPRDASSVISCGICNTVFSSEKFLKFHMR 196
            .|.:|     |...:||.|..:.|                  .|..|. |....||....|.|:.
Mouse   522 PPESELLFYYSRNYAQQIGVPEHP------------------DVHLCN-CGKECSSYSEFKAHLT 567

  Fly   197 IHENRAPKSIQDALPIGAHQQYSELDQFYCEICNKSFDETLLTVHKQMHQQESSEIMCSICNRKF 261
            .|       |.:.||...|.                      :.|...|.:| .:..||:|.:.|
Mouse   568 SH-------IHNHLPSQGHS----------------------SSHGPSHSKE-RKWKCSMCPQAF 602

  Fly   262 ENEVTYQMHQKIH--EKPRDSESSRKLAQRTSLDKEKPGFPCQYCERVFTRPFEKVKHERVHTGE 324
            .:.....:|...|  .||.                     .|.:|.:.|:.|.....|.::|||:
Mouse   603 ISPSKLHVHFMGHMGMKPH---------------------KCDFCSKAFSDPSNLRTHLKIHTGQ 646

  Fly   325 KPYACEVCGKTFRVSYSLTLHLRTHTNIRPYVCTVCNKRFKSHQVYSHHLRIHSSERQFSCDACP 389
            |.|.|.:|.|:|.....|..|:..||..:...|..|:|.|...|....|:.||:.|||..|..|.
Mouse   647 KNYRCTLCDKSFTQKAHLESHMVIHTGEKNLKCDYCDKLFMRRQDLKQHVLIHTQERQIKCPKCD 711

  Fly   390 KTFRTSVQLYAHKNTH--TKPYRCAVCNRPFSSMYAVKNHMQTHKEISSKGS 439
            |.|..:..|..|.|:|  .:.|.|..|.:.:.:.|.:..|::|.||.||..|
Mouse   712 KLFLRTNHLKKHLNSHEGKRDYVCEKCTKAYLTKYHLTRHLKTCKEPSSSSS 763

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
zf-H2C2_2 316..336 CDD:290200 9/19 (47%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 341..366 CDD:290200 8/24 (33%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
C2H2 Zn finger 411..431 CDD:275368 4/19 (21%)
Prdm4NP_857633.2 zf_PR_Knuckle 361..398 CDD:375871 8/39 (21%)
PR-SET_PRDM4 401..540 CDD:380966 25/150 (17%)
C2H2 Zn finger 550..569 CDD:275368 6/19 (32%)
C2H2 Zn finger 595..615 CDD:275368 5/19 (26%)
zf-C2H2 621..643 CDD:333835 5/42 (12%)
C2H2 Zn finger 623..643 CDD:275368 5/19 (26%)
zf-H2C2_2 635..660 CDD:372612 10/24 (42%)
C2H2 Zn finger 651..671 CDD:275368 6/19 (32%)
zf-H2C2_2 663..686 CDD:372612 7/22 (32%)
C2H2 Zn finger 679..699 CDD:275368 6/19 (32%)
zf-H2C2_2 691..716 CDD:372612 10/24 (42%)
C2H2 Zn finger 707..727 CDD:275368 7/19 (37%)
C2H2 Zn finger 735..754 CDD:275368 4/18 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 757..803 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.