DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and Zfp280b

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_803426.2 Gene:Zfp280b / 64453 MGIID:1927865 Length:534 Species:Mus musculus


Alignment Length:405 Identity:91/405 - (22%)
Similarity:141/405 - (34%) Gaps:93/405 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PLWELVEEVPANVKAEKDQNEPSNSDRYFCYDCHSIFENRNKAEEHICPRAESGGS--------- 145
            ||.|      ::.::...|..||:|.:     |.|.....:.:|......|.|||.         
Mouse   127 PLSE------SDYRSSSPQVVPSSSSK-----CCSPLVTLSSSENSPVKAALSGGDLNENLYVSK 180

  Fly   146 -----SQQDGDAKAPVRRKLAS------------VSARTGPRDASSVISCGICNTVFSSEKFLKF 193
                 :.|..|....:...|:|            :..||...||.:.:|..:             
Mouse   181 CHFSINPQRPDHSIEIVEPLSSALPPSGTFHTSNMQQRTPSFDAPNSLSRLV------------- 232

  Fly   194 HMRIHENRAPKSIQDALPIGAHQQYSELDQ--FYCEICNKSFDE-----TLLT------VHK--- 242
                  |.||.|...|.|    :|.|.|.:  |......::||.     |||.      .:|   
Mouse   233 ------NGAPPSEDSAHP----RQDSGLAEADFSSPASQETFDPKKGSLTLLLSDFYYGQYKGDG 287

  Fly   243 QMHQQESSEIMCSICNRKFENEVTYQMHQKIHEKPRDSESSRKLAQRTSLDKEKPGFPCQYCERV 307
            :..|:..:...|..|.:..:| |.:..|.|.|         .:|.::.|.|..:....|..|.|.
Mouse   288 KPEQKTHTTFKCPSCLKALKN-VKFMNHTKHH---------LELERQGSEDAWESHTTCLRCHRQ 342

  Fly   308 FTRPFEKVKH-ERVHTGEKP-YACEVCGKTFRVSYSLTLHLRTH--TNIRPYVCTVCNKRFKSH- 367
            |..||:...| :||||...| ..|::|..:|.....|..|::.:  ....||||.||..|.... 
Mouse   343 FDSPFQLECHIDRVHTSPDPSVVCKICELSFETDQVLLQHMKDNHKPGEMPYVCQVCKYRSSGFA 407

  Fly   368 QVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAHKNTH--TKPYRCAVCNRPFSSMYAVKNHMQT 430
            .|.:|..:.|.:.:...|..|.|.|:|.:....|...|  ...::|:.|...|.:......|...
Mouse   408 DVETHFTKCHVNTKNLLCPFCLKIFKTGMPYMCHYRGHWERSGHQCSKCRLQFLTFKEKMEHKTQ 472

  Fly   431 HKEISSKGSVGSGTP 445
            ..::..|.....|.|
Mouse   473 CHQMFKKPKQLEGLP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
C2H2 Zn finger 301..321 CDD:275368 8/20 (40%)
zf-H2C2_2 316..336 CDD:290200 8/21 (38%)
C2H2 Zn finger 329..349 CDD:275368 5/19 (26%)
zf-H2C2_2 341..366 CDD:290200 9/26 (35%)
C2H2 Zn finger 357..377 CDD:275368 6/20 (30%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
C2H2 Zn finger 411..431 CDD:275368 4/19 (21%)
Zfp280bNP_803426.2 DUF4195 53..221 CDD:404681 20/104 (19%)
C2H2 Zn finger 336..357 CDD:275368 8/20 (40%)
C2H2 Zn finger 366..387 CDD:275368 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.