DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and ZNF280C

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_060136.1 Gene:ZNF280C / 55609 HGNCID:25955 Length:737 Species:Homo sapiens


Alignment Length:512 Identity:108/512 - (21%)
Similarity:188/512 - (36%) Gaps:114/512 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SEEVGEEDIVYADVPLWELVEE-------VPANVKAEKDQN------EPSNSDRYFCYDCHSIFE 127
            :.:||.::   :.:.|::..:|       :|| :..|..:|      .||.|      ..:|:..
Human   132 NSQVGSDN---SSILLFDSTQESLPPSQDIPA-IFREGMKNTSYVLKHPSTS------KVNSVTP 186

  Fly   128 NRNKAEEHICPRAESGGSSQQDGDAKAPVRRKLASVSART-GPRDASS--VISCGICNTVFSSEK 189
            .:.|..|.: |:.....|....|.......:.:.|....| .|.||.:  :.:|..||..|:...
Human   187 KKPKTSEDV-PQINPSTSLPLIGSPPVTSSQVMLSKGTNTSSPYDAGADYLRACPKCNVQFNLLD 250

  Fly   190 FLKFHMRIHENRAPKSIQDAL--------PIGAHQQYSE-------LDQFYCEICNKSFDETLLT 239
            .||:||:   :..|..|...|        |....:..||       :::||            ..
Human   251 PLKYHMK---HCCPDMITKFLGVIVKSERPCDEDKTDSETGKLIMLVNEFY------------YG 300

  Fly   240 VHKQMHQQES---SEIMCSICNRKFENEVTYQMHQKIHEKPRDSESSRKLAQRTSLDKEKPGFPC 301
            .|:.:.::|.   :...|..|::..:|.:.:..|.| |....:.:::......|:         |
Human   301 RHEGVTEKEPKTYTTFKCFSCSKVLKNNIRFMNHMK-HHLELEKQNNESWENHTT---------C 355

  Fly   302 QYCERVFTRPFEKVKH-ERVHT-GEKPYACEVCGKTFRVSYSLTLHLR-TH-TNIRPYVCTVCNK 362
            |:|.|.:..||:...| |..|| .|....|::|..:|...:.|..|:: || ....||||.||  
Human   356 QHCYRQYPTPFQLQCHIESTHTPHEFSTICKICELSFETEHILLQHMKDTHKPGEMPYVCQVC-- 418

  Fly   363 RFKS---HQVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAHKNTHTKP--YRCAVCNRPFSSMY 422
            :|:|   ..|.:|....|.:.:...|..|.|..:.:.....|...|.|.  :||..|...|.:..
Human   419 QFRSSTFSDVEAHFRAAHENTKNLLCPFCLKVSKMATPYMNHYMKHQKKGVHRCPKCRLQFLTSK 483

  Fly   423 AVKNHMQTHK---------------EISSKGSVGSGTPNIKSA------ATSKSQAAGKFYCNTC 466
            ....|...|:               :::.:.|:|.....:.:|      .||..|.......||.
Human   484 EKAEHKAQHRTFIKPKELEGLPPGAKVTIRASLGPLQSKLPTAPFGCAPGTSFLQVTPPTSQNTT 548

  Fly   467 GAEYARLFALRLHMKSAHGLVEEQENPATSTDAAHVAETDDSETAVLIAAAEADAAY 523
            .....:..|.|......|         ||::.|:.|   :.|:....||.::|..:|
Human   549 ARNPRKSNASRSKTSKLH---------ATTSTASKV---NTSKPRGRIAKSKAKPSY 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
C2H2 Zn finger 301..321 CDD:275368 8/20 (40%)
zf-H2C2_2 316..336 CDD:290200 7/21 (33%)
C2H2 Zn finger 329..349 CDD:275368 5/20 (25%)
zf-H2C2_2 341..366 CDD:290200 11/26 (42%)
C2H2 Zn finger 357..377 CDD:275368 7/22 (32%)
C2H2 Zn finger 385..405 CDD:275368 4/19 (21%)
C2H2 Zn finger 411..431 CDD:275368 4/19 (21%)
ZNF280CNP_060136.1 DUF4195 46..227 CDD:316361 19/105 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..137 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..223 10/53 (19%)
C2H2 Zn finger 355..376 CDD:275368 8/20 (40%)
C2H2 Zn finger 385..406 CDD:275368 5/20 (25%)
C2H2 Zn finger 415..433 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 535..602 16/71 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.