DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and ZNF280D

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001275517.1 Gene:ZNF280D / 54816 HGNCID:25953 Length:979 Species:Homo sapiens


Alignment Length:504 Identity:109/504 - (21%)
Similarity:178/504 - (35%) Gaps:112/504 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSNQAEETTPNLHVEDGDLSGGALQQEFL---YCESCGNVYEDTESYDRAHGPQAGCCTGASGEL 64
            :||....:..|.|.|........:.|.|.   |..:...|                 .:..|.||
Human    97 TSNPVPASPINFHPESRSSDSSVIVQPFSKPGYITNSSRV-----------------VSNKSSEL 144

  Fly    65 DFIEEVAEDC-ISEEVGEEDIVYADVPLWELVEEVPA-----NVKAEKDQNEPSNSDRYFCYDCH 123
            .|  ::.:|. :|...|...:..|.:.....:.:.|:     ||..:|.  :||.|         
Human   145 LF--DLTQDTGLSHYQGGPTLSMAGMSESSFLSKRPSTSEVNNVNPKKP--KPSES--------- 196

  Fly   124 SIFENRNKAEEHICPRAESGG-SSQQDGDAKAPVRRKLASVSARTGPRDASSVISCGICNTVFSS 187
              ....|.:.  :.|..:|.. :|.|...||........|.:....||      :|..||..|:.
Human   197 --VSGANSSA--VLPSVKSPSVTSSQAMLAKGTNTSSNQSKNGTPFPR------ACPKCNIHFNL 251

  Fly   188 EKFLKFHMRIHENRAPKSIQDALPIGAHQQYSELDQFYCEICNKSFD----ETLLTVHK------ 242
            ...||.||:.   ..|..|.:.|.:...:..|.:::      |.:.|    :.::.|:.      
Human   252 LDPLKNHMKY---CCPDMINNFLGLAKTEFSSTVNK------NTTIDSEKGKLIMLVNDFYYGKH 307

  Fly   243 ----QMHQQESSEIMCSICNRKFENEVTYQMHQKIHEKPRDSESSRKLAQRTSLDKEKPGFPCQY 303
                |..|:..:...|..|.:..:|.:.:..|.| |....:.:||......|:         ||:
Human   308 EGDVQEEQKTHTTFKCFSCLKILKNNIRFMNHMK-HHLELEKQSSESWENHTT---------CQH 362

  Fly   304 CERVFTRPFEKVKH-ERVHT-GEKPYACEVCGKTFRVSYSLTLHLRTH--TNIRPYVCTVCNKRF 364
            |.|.|..||:...| |..|| .|....|::|..:|...:.|..|::.:  ....||||.|||.|.
Human   363 CYRQFPTPFQLQCHIESTHTPHEFSTICKICELSFETEHVLLQHMKDNHKPGEMPYVCQVCNYRS 427

  Fly   365 KSHQVYSHHLRI-HSSERQFSCDACPKTFRTSVQLYAHKNTHTKP--YRCAVCNRPFSSMYAVKN 426
            .|......|.|. |.:.:...|..|.|..:.:.....|...|.|.  :||..|...|.:.....:
Human   428 SSFSDVETHFRTSHENTKNLLCPFCLKVIKIATPYMHHYMKHQKKGIHRCTKCRLQFLTCKEKMD 492

  Fly   427 HMQTH----------------KEISSKGSVG------SGTPNIKSAATS 453
            |...|                .:::.:.|||      |.||:|.::|::
Human   493 HKTQHHRTFIKPKQLEGLPPGTKVTIRASVGPLQSGASPTPSISASAST 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
C2H2 Zn finger 301..321 CDD:275368 9/20 (45%)
zf-H2C2_2 316..336 CDD:290200 7/21 (33%)
C2H2 Zn finger 329..349 CDD:275368 5/19 (26%)
zf-H2C2_2 341..366 CDD:290200 10/26 (38%)
C2H2 Zn finger 357..377 CDD:275368 8/20 (40%)
C2H2 Zn finger 385..405 CDD:275368 4/19 (21%)
C2H2 Zn finger 411..431 CDD:275368 4/19 (21%)
ZNF280DNP_001275517.1 DUF4195 45..229 CDD:290548 31/165 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..119 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..236 17/93 (18%)
C2H2 Zn finger 360..381 CDD:275368 9/20 (45%)
C2H2 Zn finger 390..411 CDD:275368 5/20 (25%)
C2H2 Zn finger 420..439 CDD:275368 7/18 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 523..608 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 739..809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 896..979
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.