DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and CG3281

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_650132.1 Gene:CG3281 / 41445 FlyBaseID:FBgn0260741 Length:538 Species:Drosophila melanogaster


Alignment Length:457 Identity:111/457 - (24%)
Similarity:181/457 - (39%) Gaps:112/457 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TTPNLHVEDGDLSGGALQQEFLYCESCG----NVYEDTESYDRAHGPQAGCCTGASGELDFIEEV 70
            |.|||.:.              .|::|.    ..||.....:.||              :.::.:
  Fly    56 TDPNLPMH--------------LCQNCARRLIGAYEFIVEVENAH--------------ETLQNL 92

  Fly    71 AEDCISEEVGEEDIVYADVPLWELVEE-----VPANVKAEKDQNEPSNSDRYFCYDCHSIFENRN 130
            .|.  .|...:.|.|:.||.  ||:::     :...:.....:......::|...|| |.|.: :
  Fly    93 FEQ--QEVAAKPDEVHVDVV--ELIDQDDVVSMAQYLSTSFAEQHVEMEEKYGDQDC-SAFTS-D 151

  Fly   131 KAEEHICPRAESGGSSQQDGDAKAP----VRRKLASVSARTGPR---DASSVISCGICNTVFSSE 188
            ..||.:. .:|......:|.....|    :..:..|..::.|.|   .|:.:..|.:|..||:..
  Fly   152 VGEEPLY-ASEDRDDEPEDSFQLKPRPDEIENRELSRPSQLGSRLNHSANFIYKCAVCPRVFAKS 215

  Fly   189 KFLKFHMRIHENRAPKSIQDALPIGAHQQYSELDQFYCEICNKSFDETLLTVHKQMHQQESSEIM 253
            :.|..|.    ::|.|...|...:              ::.|:|....|||              
  Fly   216 ESLTRHF----SQAHKLTADVAAM--------------KLANESCGTGLLT-------------- 248

  Fly   254 CSICNRKFENEVTYQMH-QKIH--------EKPRDSESSRKLAQRTSLDKEKPGFPCQYCERVFT 309
            |..|.|.|:.:.|.:.| |..|        |:..|:.:.:::|:|..         |.:|...| 
  Fly   249 CEHCPRTFKRQDTLRRHMQAFHPDAIALEPEETTDNSARKRIAKRRD---------CPHCGLSF- 303

  Fly   310 RPFEKVK-HERVHTGEKPYACEVCGKTFRVSYSLTLHLRTHTNIRPYVCTVCNKRFKSHQVYSHH 373
             |...:. |.|.|||:.||.|:.|.|.|..|..|:||:|.||..||..|.:|:|:|.|....:.|
  Fly   304 -PVSSLTIHIRRHTGDNPYKCDQCEKAFPRSQDLSLHMRQHTGERPSECKICSKKFISQNKLARH 367

  Fly   374 LRIHSSERQFSCDACPKTFRTSVQLYAHKNTHT--KPYRCAVCNRPFSSMYAVKNHMQTHKEISS 436
            :|:|:.:|.:||..|.|:|..|..|..|...||  :||:|.||...|    ...:|:..|:  :.
  Fly   368 MRLHTGQRPYSCKMCSKSFVQSNDLKIHMRRHTGERPYQCGVCGESF----VCGSHLNIHR--NR 426

  Fly   437 KG 438
            ||
  Fly   427 KG 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 7/20 (35%)
C2H2 Zn finger 301..321 CDD:275368 6/20 (30%)
zf-H2C2_2 316..336 CDD:290200 10/20 (50%)
C2H2 Zn finger 329..349 CDD:275368 9/19 (47%)
zf-H2C2_2 341..366 CDD:290200 12/24 (50%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
C2H2 Zn finger 411..431 CDD:275368 5/19 (26%)
CG3281NP_650132.1 zf-AD 14..92 CDD:285071 10/63 (16%)
C2H2 Zn finger 205..226 CDD:275368 6/24 (25%)
C2H2 Zn finger 249..266 CDD:275368 5/16 (31%)
COG5048 <294..>391 CDD:227381 39/107 (36%)
C2H2 Zn finger 296..315 CDD:275368 6/20 (30%)
zf-H2C2_2 307..330 CDD:290200 10/22 (45%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
zf-H2C2_2 335..358 CDD:290200 11/22 (50%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-H2C2_2 364..388 CDD:290200 9/23 (39%)
C2H2 Zn finger 379..399 CDD:275368 7/19 (37%)
zf-H2C2_2 391..416 CDD:290200 10/28 (36%)
C2H2 Zn finger 407..424 CDD:275368 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2696
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.