DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and CG8478

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster


Alignment Length:352 Identity:79/352 - (22%)
Similarity:133/352 - (37%) Gaps:84/352 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GASGELDFIEEVAEDCISEEVGEEDIVYADVPLWELVEEVPANVKAEKDQNEPSNSDRYF----- 118
            ||..|:..:.||..: :||.:.:...:.||     .|:...:.:|.|..:...|.|..|.     
  Fly   225 GAEKEVAHVNEVVNE-VSELIAKALKISAD-----SVKPATSKLKVEAGKKRQSMSSTYSGAALP 283

  Fly   119 ----CYDCHSIFENRN---KAEEHIC----------PRAESGGSSQQDGD-------AKAPVRRK 159
                .|...:..|.|.   |....:.          .|:..||.|.....       .|:.:|:.
  Fly   284 RPRRSYLPTTTAETRTYSFKQRMSVVVKTTLNSPARKRSVGGGVSLSRRSCLPVSKLTKSSIRKS 348

  Fly   160 LASVSARTGPRDAS------------SVISCGICNTVFSSEKFLKFHMRIHE--NRAPKSIQ--D 208
            ||..|.|:..:.||            .|.||..|:|.|..:..|..|||:|:  :....:::  :
  Fly   349 LAVTSVRSPEKIASKPAKTSTKSIPEKVFSCKNCSTTFRVKSLLDVHMRMHDPVDNGANTLKRLN 413

  Fly   209 ALPIGAHQQYSELDQFYCEICNKSFD-ETLLTVHKQMHQQESSEIMCSICNRKFENEVTYQMHQK 272
            :.|:.|     .:.:..|:.|:|:|. |..|.:|.   .|...:|..|   .|.:.|.|...|:|
  Fly   414 SNPVAA-----GVSKNRCKFCDKNFALERALHIHL---MQNCDKIPPS---EKRKLEFTELNHEK 467

  Fly   273 IHEKPRDSESS---------RKLAQRTSLDKEKPGFPCQYCERVFTRPFEKVKHERVHTG----- 323
            ..:.|:...:|         :|..||.|...:..  |.|..:.:.....:|:.....|.|     
  Fly   468 KAQLPKIGGTSGINHPMTMPQKPQQRISTIPKLA--PSQGTQSMAPPSVKKIPKNVAHAGVYRTP 530

  Fly   324 EKPYACEVCGKTFR-----VSYSLTLH 345
            .|...|.:|.::||     .::|||:|
  Fly   531 TKTVPCHICKQSFRSILEFTNHSLTVH 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
C2H2 Zn finger 301..321 CDD:275368 2/19 (11%)
zf-H2C2_2 316..336 CDD:290200 5/24 (21%)
C2H2 Zn finger 329..349 CDD:275368 8/22 (36%)
zf-H2C2_2 341..366 CDD:290200 4/5 (80%)
C2H2 Zn finger 357..377 CDD:275368
C2H2 Zn finger 385..405 CDD:275368
C2H2 Zn finger 411..431 CDD:275368
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 9/21 (43%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..444 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.