DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and CG1024

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster


Alignment Length:564 Identity:100/564 - (17%)
Similarity:182/564 - (32%) Gaps:168/564 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LQQEFLY-CESCGNVYEDTESYDRAHGPQAGCCTGASGELDFIEEVAEDC----ISEEVGEEDIV 85
            |:...:| |..||..:. |::..|.|         .:.:.|::::...|.    |.|...|..:.
  Fly    22 LEAHMVYICPECGKAFR-TQAEWRQH---------LNTKHDYLKKTYSDFNFIQIDERFHECQLC 76

  Fly    86 YADVPLWELVEEVPANVKAEKDQ--NEPSNSDRYFCYDCHSIFENRNKAEEHIC----------- 137
            :.    |  ||.....:...:..  ....:|:.|.|..|...:..|.....|:.           
  Fly    77 FK----W--VENAHKTIALLQYHYFMHLEHSETYRCVHCRMAYTRRRALNVHLLDTHMREIEKYE 135

  Fly   138 --------PRAESGGSSQQDGDAKAPVRRKLASVSARTGPRDASSVISCGICNTVFSSEKFLKFH 194
                    .:|:...::...|:|:.|:     :|..|..|:.:::                    
  Fly   136 NKLRQMKRQQAKPTTAAAPAGNAEKPM-----AVKPRGRPKGSTN-------------------- 175

  Fly   195 MRIHENRAPKSIQD---------------ALPIGAHQQYSELDQFYCEICNKSFDETLLTVHKQM 244
             |...:...|::.|               |.|:...:..|.:.:...:.|..::::.:....|::
  Fly   176 -RKQNDLLQKALMDIDLNTEMEKSPVTALAAPVNEPKPISNVSELNLDRCLNAYEDIVRKEEKEV 239

  Fly   245 HQQESSEIMCSICNRKFE----------NEVTYQMHQKIHEKPR-------DSESSRKLAQRTSL 292
            ..:...| :.::|...|:          ||...|....:.:..:       |:....::||   |
  Fly   240 VPKYDDE-LDALCKEFFDDGPSAGKGEANEEQQQDDAHLQQGNQEVVIIEIDALGKEEVAQ---L 300

  Fly   293 DKEKPGFPCQY---CERVFTRPFEKVKHERVHTGEK---PYACEVCGKTFRVSYSLTLHLRTHTN 351
            .||....|...   ..|:.|.|......|....|..   .|.|..|||..........|:     
  Fly   301 KKEMKSDPISQPTKRRRISTTPSRDSDTEMSTNGLTKLISYLCPKCGKEIASMDGWRAHV----- 360

  Fly   352 IRPYVCTVCNKRFKSH---QVYSHHLRIHSSERQFSCDAC----PKTFRTSVQLYAHKNTHTKPY 409
                        ||.|   .:..:..:|..|.|:..|..|    |.|.|:.:|.:..|:.   ||
  Fly   361 ------------FKKHDFEHIIENSFKILESGRKAMCLQCREVQPTTVRSQLQKHCFKHL---PY 410

  Fly   410 R----CAVCNRPFSSMYAVKNHMQ-THKE---------ISSKGSVGSGTPNIKSAATSKSQAAG- 459
            |    |.:|:|..:|...:.||:: .|:|         :..|......:|| ||...:.:..|| 
  Fly   411 RSYLKCTLCDRTKTSTSKILNHIRYNHQEELQRKNKTQLLIKPEPMWASPN-KSGQAAMADDAGS 474

  Fly   460 ------KFYCNTCGAEYARLFALRLHM---------KSAHGLVE 488
                  :..|..|...:...:....|:         ||..|.||
  Fly   475 EDDQGEQAVCEHCDRVFRSKWRYERHIASCRRSGAGKSVEGTVE 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/29 (17%)
C2H2 Zn finger 301..321 CDD:275368 4/22 (18%)
zf-H2C2_2 316..336 CDD:290200 7/22 (32%)
C2H2 Zn finger 329..349 CDD:275368 5/19 (26%)
zf-H2C2_2 341..366 CDD:290200 2/24 (8%)
C2H2 Zn finger 357..377 CDD:275368 3/22 (14%)
C2H2 Zn finger 385..405 CDD:275368 7/23 (30%)
C2H2 Zn finger 411..431 CDD:275368 6/20 (30%)
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368 6/30 (20%)
C2H2 Zn finger 73..100 CDD:275368 3/32 (9%)
C2H2 Zn finger 106..123 CDD:275368 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.