DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and CG14655

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster


Alignment Length:494 Identity:122/494 - (24%)
Similarity:181/494 - (36%) Gaps:134/494 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 DCHSIFENRNKAEEHICPR----AESGGSSQQDGD--------AKAPVRRKLASVSAR-----TG 168
            :|..:|...:|...|:...    |:.|..|..:|.        |.||.:|:.....::     ..
  Fly    40 NCKELFLGLDKLTIHLFSHTSLMAQEGNESPANGQPASSRGFLAAAPPKRRAKRTRSKPVVPTPP 104

  Fly   169 PRDASSVISCGICNTVFSSEKFLKFHMR-IHENRAPKSIQDALPIGAHQQYSELDQ--FYCEICN 230
            |...:....|.||...|.:.:....|:| :|||      .:..|.....|..|.||  :.|.:|:
  Fly   105 PVRTTPPAHCDICEFSFRNTELRDMHVRLVHEN------AEGEPKQKEPQQKEPDQEPYKCHLCS 163

  Fly   231 KSFD-ETLLTVH-KQMHQQESSEIMCSICN---------RKFENEVTYQMHQKIHEKPRDSESSR 284
            |:|. :..|.:| |.:|..   .:.||..|         ....:.||......|.::.|.:|...
  Fly   164 KTFRMKGSLRIHLKVVHMM---GVPCSNPNPNPNPSPTPASTTSAVTATPKLSICDRIRHTEPGA 225

  Fly   285 ---------------KLAQRTSLDKEKPGFP-----------CQYCERVFTRPFEKVKHERVHTG 323
                           .|:...|:.::.|..|           |..|.:.||..:...||:|:|||
  Fly   226 LGNGNNSTCTASQPYALSGALSMLQQSPSSPESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTG 290

  Fly   324 EKPYACEVCGKTFRVSYSLTLHLRTHTNIRPYVCTVCNKRFKSHQVYSHHLRIHSSERQFSCDAC 388
            |.||.||:|.:||....|...||..|:.::|:||.||.:.||......:|.||||.|:.|.|:.|
  Fly   291 EMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVC 355

  Fly   389 PKTFRTSVQLYAHKNTHT--KPYRCAVCNRPFSSMYAVKNHMQTHKEISSKGSVGSGTPNIKSAA 451
            .|.||..|....|...||  .||:|.:|.:.|  .|.|.  .:||:                   
  Fly   356 GKCFRQRVSFLVHTRIHTGVMPYKCELCQKTF--RYKVS--QRTHR------------------- 397

  Fly   452 TSKSQAAGKFYCNTCGAEYARLFALRLHMKSAHGLVEEQENPATSTDAAHVAETDDSETAVLIAA 516
                       |.|                      ||.:.|.....|  ..|.:||.|....|:
  Fly   398 -----------CPT----------------------EEAQTPEQLIKA--FLEGNDSHTQPSPAS 427

  Fly   517 AEADAAYINAVVNDVDIVGTVPTYEECVVFDVDNFHSEE 555
            ||.      |.:|...||.  |..|..:...:|:...|:
  Fly   428 AEI------AAINSSSIVD--PEQEALLSQSIDDIVVEQ 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/28 (18%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
zf-H2C2_2 316..336 CDD:290200 12/19 (63%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 341..366 CDD:290200 10/24 (42%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
C2H2 Zn finger 411..431 CDD:275368 5/19 (26%)
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
zf-H2C2_2 281..304 CDD:290200 13/22 (59%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
zf-H2C2_2 339..361 CDD:290200 11/21 (52%)
C2H2 Zn finger 352..372 CDD:275368 7/19 (37%)
zf-H2C2_2 364..389 CDD:290200 8/26 (31%)
C2H2 Zn finger 380..396 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2696
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.