DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and CG10654

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:486 Identity:102/486 - (20%)
Similarity:155/486 - (31%) Gaps:186/486 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AEETTPNLHVEDGDLSGGALQQEFLYCESCGNVYEDTESYDRAHGPQAGC--------------- 56
            |:.||......||  ..||   :.:.|.:|..:.          |||..|               
  Fly    19 ADSTTTTTSGMDG--CDGA---KTMICRACLVLL----------GPQDACHNLDSEQDLASKYYG 68

  Fly    57 CTGASGELDF-----IEEVAEDC-------------ISEEVGE-----EDIVYADVPLWELVEEV 98
            |||.....|.     ::.:.|.|             .:|.:..     :||   |:...:|.:..
  Fly    69 CTGEDAVRDLPPQLVLKSICECCYQLVQKFHDFQRMCAESLRNFEKLLQDI---DIGCHKLEDHT 130

  Fly    99 PANVKAEKDQNEPSNSDRYFCYDCHSIFENRNKAEEH------------------------ICPR 139
            ..::....:.||.:|.:                |:.|                        |..|
  Fly   131 WHDLDTPSESNESTNPE----------------AQSHAPCIAATQEIVSFIWPQVCLPLAVILSR 179

  Fly   140 AESGGSSQQD-------------GDAKAPVRRKLASVSARTGPRDASSVISCGICNTVFSSEKFL 191
            ...|.|.:::             |..|..:..||.....|.|.|   ..:.|.||:..|.....|
  Fly   180 ITLGASLEEEVYVIEDESAKQDLGQEKLSISSKLLGARKRRGVR---HTLECRICHRGFYKPSLL 241

  Fly   192 KFHMRIHENRAPKSIQDALPIGAHQQYSELDQFYCEICNKSFDE-TLLTVH-KQMHQQ-ESSEIM 253
            :.||:.||...|                    :.|..|.||:.. .||..| :|||.. :::.|:
  Fly   242 EAHMQQHEGLRP--------------------YTCVHCAKSYARANLLESHLRQMHNNADAARII 286

  Fly   254 --CSICNRKFENEVTYQMHQKIHEKPRDSESSRKLAQRTSLDKEKPGFPCQYCERVFTRPFEKVK 316
              |..||:.:....:.:.|.:                ||                          
  Fly   287 YACPSCNKVYTANRSLKYHMR----------------RT-------------------------- 309

  Fly   317 HERVHTGEKP---YACEVCGKTFRVSYSLTLHLRTHTNI--RPYVCTVCNKRFKSHQ-VYSHHLR 375
            |||.|..|.|   :.||.|||.|.....||.|...|.::  |.|.|..|::||.:.: :..|.||
  Fly   310 HERYHESESPDARHICEECGKCFARKAHLTRHKMVHGSVEGRRYCCECCDRRFYTKENMVDHLLR 374

  Fly   376 IHSSER-QFSCDACPKTFRTSVQLYAHKNTH 405
            .|.::. ...|..|.:.|:.||:|.||...|
  Fly   375 KHGNKNLLLRCRKCGRIFQNSVELNAHGRKH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 4/19 (21%)
C2H2 Zn finger 301..321 CDD:275368 3/19 (16%)
zf-H2C2_2 316..336 CDD:290200 11/22 (50%)
C2H2 Zn finger 329..349 CDD:275368 9/19 (47%)
zf-H2C2_2 341..366 CDD:290200 10/26 (38%)
C2H2 Zn finger 357..377 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..405 CDD:275368 8/19 (42%)
C2H2 Zn finger 411..431 CDD:275368
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071 13/85 (15%)
C2H2 Zn finger 228..248 CDD:275368 7/19 (37%)
C2H2 Zn finger 256..313 CDD:275368 19/98 (19%)
C2H2 Zn finger 289..314 CDD:275368 9/66 (14%)
zf-C2H2 323..345 CDD:278523 9/21 (43%)
C2H2 Zn finger 325..345 CDD:275368 9/19 (47%)
C2H2 Zn finger 355..376 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..405 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.