DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and CG43347

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001138185.2 Gene:CG43347 / 31991 FlyBaseID:FBgn0263072 Length:2684 Species:Drosophila melanogaster


Alignment Length:616 Identity:129/616 - (20%)
Similarity:196/616 - (31%) Gaps:212/616 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SYDRAHGPQAGCCTGASGE-LDFIEEVAEDCISEEVGEEDIVYADVPLWELVEEVPANVKAEKDQ 108
            |||. |..:.|...|.:.| .|..||:.|:.::.|:..|.                 |...|:|:
  Fly   878 SYDE-HDDEPGAGLGGNDEDDDDDEELDEEALAREMKMEQ-----------------NFVEEEDE 924

  Fly   109 NEPSNSDRYFCYDC-----HSI-------------------FENRN-------KAEEHICPRAES 142
            ::.:......|.:|     |.:                   .|.||       ||:.....:..|
  Fly   925 HDIAFRSHQSCRECSIAHDHKLCPLRNACGNVTDAVDLGEWIERRNLEALAKLKADAQRQAKRAS 989

  Fly   143 GGSSQQDGD------------------------------AKAP-------VRRKLASVSARTGPR 170
            |....:|.|                              |..|       |...:..|.|||..|
  Fly   990 GRQRHEDDDMEDMEDMDMDMDESSQLSELETKPLITFAEASVPAEFELHNVEPNVTGVFARTEVR 1054

  Fly   171 DASSVISCGICNTVFSSEKFLKFHMRIHENRAPKSIQDALPIGAHQQYSELDQFYCEICNK---- 231
             |.:.:...|...|.:.|        :.|....|.|.:....||       |:.|...|:.    
  Fly  1055 -AFTKLGPLIGQPVQTGE--------VREGSDMKWIFEMCEAGA-------DKSYLLCCDNPNAS 1103

  Fly   232 ----------SFDE---TLLTVHKQMH-------------------------QQESSEIMCSICN 258
                      |::|   .|:::.:|.:                         ::.:.:..|..||
  Fly  1104 NWLRFVRPAPSYEERNVNLVSIDRQAYFVSCRDLRNGMELLYWSDDCNTMWRKKHTEKTNCGGCN 1168

  Fly   259 RKFENEVTYQMHQKIHEKPRDSESSRKLAQRTSLDKEKPGFPCQYCERVFTRPFEKVKH-ERVHT 322
            .|||:.:.|:.|..:...|..|.:.||             :.|:.|..........:|| ...|.
  Fly  1169 LKFEHPLYYRTHCSVFHDPSMSLTIRK-------------YHCKVCGEPVLGKDNIMKHAAEKHD 1220

  Fly   323 GEKPYACEVCGKTF-RVSYSLTLHLRTH------TNIRPYVCTVCNKRFKSHQVYSHHL-RIHSS 379
            |:..|.|:.|.|.| |::| |.:| ||:      ...|| ||..|.::|...|....|: |:||.
  Fly  1221 GKGAYQCQFCSKFFLRLNY-LEMH-RTYGCASNPNRSRP-VCDFCGRKFCQPQKLKAHIKRMHSD 1282

  Fly   380 E----RQFSCDACPKTFRTSVQLYAH-KNTHTK---PYRCAVCNRPFSSMYAVKNHMQTHKEISS 436
            .    |.|.|..|.|...:...|..| |..|::   ...|..|.:.|.:...:|.||.||     
  Fly  1283 MAEVLRDFQCKLCSKLLGSRAALQRHSKEVHSRNSTVVSCPRCQKLFQNRSNLKIHMLTH----- 1342

  Fly   437 KGSVGSGTPNIKSAATSKSQAAGKFYCNTCGAEYARLFALRLHMKSAHGLVEEQENPATSTDAAH 501
                 ||....|.|...            |.|.:.....|:.|.|..|...:|| .|......|:
  Fly  1343 -----SGVRPFKCAEPE------------CNAAFTTKQCLQFHYKKVHNYTQEQ-MPKIERSVAY 1389

  Fly   502 VAET-----------DDSETAVLIAAAEADA 521
            ..:.           ..:.||...:||.|.|
  Fly  1390 TFDAYSGGMKVDFLGKQTATATPASAASAQA 1420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
C2H2 Zn finger 301..321 CDD:275368 4/20 (20%)
zf-H2C2_2 316..336 CDD:290200 8/20 (40%)
C2H2 Zn finger 329..349 CDD:275368 9/20 (45%)
zf-H2C2_2 341..366 CDD:290200 10/30 (33%)
C2H2 Zn finger 357..377 CDD:275368 6/20 (30%)
C2H2 Zn finger 385..405 CDD:275368 6/20 (30%)
C2H2 Zn finger 411..431 CDD:275368 6/19 (32%)
CG43347NP_001138185.2 NR_DBD_like 1198..>1268 CDD:295381 23/72 (32%)
C2H2 Zn finger 1198..1219 CDD:275368 4/20 (20%)
C2H2 Zn finger 1227..1255 CDD:275368 10/29 (34%)
C2H2 Zn finger 1259..1280 CDD:275368 6/20 (30%)
C2H2 Zn finger 1292..1313 CDD:275368 6/20 (30%)
C2H2 Zn finger 1322..1342 CDD:275368 6/19 (32%)
zf-H2C2_2 1334..1361 CDD:290200 11/48 (23%)
C2H2 Zn finger 1350..1373 CDD:275368 6/34 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.