DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and CG2120

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:289 Identity:73/289 - (25%)
Similarity:110/289 - (38%) Gaps:86/289 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 PKSIQDALPI--GAHQQYSELDQFYCEICNKSFDETLLTVHKQMHQQESSEIMCSICNRKFENEV 265
            |.|..|.|.:  ||.||.:..:....::|......|     .:.|:....:..|.||:|:|....
  Fly    53 PGSEYDLLELVNGALQQRNTTEHKPTDMCKPKRTPT-----TKRHRTTGKDHTCDICDRRFSEAY 112

  Fly   266 TYQMHQKIH--EKPRDSESSRKLAQRTSLDKEKPGFPCQYCERVFTRPFEKVK-HERVHTGEKPY 327
            ..::|:..|  |||.                     .|..|.:.| |...|:: |...||.|:|:
  Fly   113 NLRIHKMTHTDEKPH---------------------VCVECGKGF-RQLNKLRIHAVTHTAERPH 155

  Fly   328 ACEVCGKTFRVSYSLTLHLRTHTNIRPYVC--TVCNKRFKS------------------------ 366
            .|::|||.||.:..||:|.|.||..:||.|  |.|:..|.|                        
  Fly   156 KCDICGKGFRYANYLTVHRRLHTGEKPYPCLATDCHLSFHSIHARRIHTKLRHAAQTDPDPEHPL 220

  Fly   367 -----------------------HQVY-SHHLRIHSSERQFSC--DACPKTFRTSVQLYAHKNTH 405
                                   .|.| |.||:.|.::|.|.|  ..|.|.|.::.:|..|:..|
  Fly   221 AEQEQRDTSALSFTCPVCSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAH 285

  Fly   406 T--KPYRCAVCNRPFSSMYAVKNHMQTHK 432
            |  :|:.|.:|...|......|.|::.|:
  Fly   286 TQQRPFACPLCPARFLRKSNHKQHLKVHE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
C2H2 Zn finger 301..321 CDD:275368 6/20 (30%)
zf-H2C2_2 316..336 CDD:290200 9/20 (45%)
C2H2 Zn finger 329..349 CDD:275368 10/19 (53%)
zf-H2C2_2 341..366 CDD:290200 12/26 (46%)
C2H2 Zn finger 357..377 CDD:275368 10/69 (14%)
C2H2 Zn finger 385..405 CDD:275368 6/21 (29%)
C2H2 Zn finger 411..431 CDD:275368 5/19 (26%)
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 6/19 (32%)
zf-H2C2_2 113..138 CDD:290200 8/46 (17%)
C2H2 Zn finger 129..149 CDD:275368 6/20 (30%)
zf-H2C2_2 142..166 CDD:290200 10/23 (43%)
COG5048 151..>264 CDD:227381 29/112 (26%)
C2H2 Zn finger 157..177 CDD:275368 10/19 (53%)
C2H2 Zn finger 185..206 CDD:275368 5/20 (25%)
C2H2 Zn finger 235..255 CDD:275368 5/19 (26%)
C2H2 Zn finger 263..285 CDD:275368 6/21 (29%)
C2H2 Zn finger 293..313 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.