DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and CG3032

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster


Alignment Length:461 Identity:100/461 - (21%)
Similarity:175/461 - (37%) Gaps:132/461 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EEVAEDC------ISEEVGEEDIVYADVPLWELVEEVPANVKAEKD-QNEPSNSD---RYFCYDC 122
            |.|.|.|      :.:|..:.::...::|:.:.:::: .|:...:| :|:.::..   ...|.:|
  Fly     8 ESVRELCCTCLLQLEKEPLKTELQSDEIPISQELQQL-LNINLSQDVENQDADQQWLPNELCLEC 71

  Fly   123 HSIFEN----RNKAEEHIC-----------PRAES------GGSSQQDG------DAKAPVRRKL 160
            .|..:|    |.||:|  |           ||..:      |....|:.      ...||....:
  Fly    72 RSAVQNFEKFRRKADE--CRKQLLEMLKKDPREPTFEVVYDGREEDQESLHGLEPPEPAPDPDPI 134

  Fly   161 ------ASVSARTGPRDASSVISCGICNTVFSSEKFLKFHMR-IHE-NRAPKSIQDALPIGAHQQ 217
                  :..|.|...|.:.:.:.|.:|...|:.:..|..|:| :|| ::.|              
  Fly   135 DEPAIKSDKSPRKSFRGSRNTLKCSVCRRSFAHQITLAAHIRKVHEGSKRP-------------- 185

  Fly   218 YSELDQFYCEICNK--SFDETLLTVHKQMHQQESSEIMCSI--CNRKFENEVTYQMHQKIHEKPR 278
                  |.|:.|.|  ||...|.|..:::|..:.....|..  |.|.:.:.:..|.|:::...||
  Fly   186 ------FQCDQCEKAYSFMGGLYTHIREVHAPKERRHPCDQPGCERIYTSRIAMQKHKRLKHSPR 244

  Fly   279 DSESSRKLAQRTSLDKEKPGFPCQYC--------------------------------ERVFTRP 311
            |.::.:|             |.|:.|                                ||.|...
  Fly   245 DRDALKK-------------FICEQCGASFNQSANLKYHLKTKHPTEDEVAAREGGAGERHFCDI 296

  Fly   312 FEKVKHER----VHT-------GEKPYACEVCGKTFRVSYSLTLHLRTHTNIRPYVCTVCNKRF- 364
            .:|..|.|    .||       .|.|:.|:|||:.....:.|..|:..|:|.: ..|..|.:|| 
  Fly   297 CQKEFHSRYTLKYHTLQQHEVQEELPHECQVCGRRMAKKFMLLQHMLMHSNDK-LPCEHCGRRFA 360

  Fly   365 KSHQVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAHKNTHT--KPYRCAVCNRPFSSMYAVKNH 427
            :..::.:|...:|...:.|.|..||::|.:...|..|:..||  |||.|..|.:.|.....:|||
  Fly   361 RRFELEAHVRAVHLKLKPFPCHHCPESFASRKTLRHHEYIHTGEKPYICDTCGQAFRQQTCLKNH 425

  Fly   428 MQTHKE 433
            .:.|::
  Fly   426 RKVHEK 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/21 (24%)
C2H2 Zn finger 301..321 CDD:275368 8/55 (15%)
zf-H2C2_2 316..336 CDD:290200 10/30 (33%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 341..366 CDD:290200 8/25 (32%)
C2H2 Zn finger 357..377 CDD:275368 5/20 (25%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
C2H2 Zn finger 411..431 CDD:275368 6/19 (32%)
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 15/84 (18%)
C2H2 Zn finger 158..179 CDD:275368 6/20 (30%)
C2H2 Zn finger 188..209 CDD:275368 7/20 (35%)
C2H2 Zn finger 218..239 CDD:275368 5/20 (25%)
C2H2 Zn finger 254..275 CDD:275368 2/20 (10%)
C2H2 Zn finger 294..315 CDD:275368 5/20 (25%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
C2H2 Zn finger 409..429 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2696
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.