DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and ZNF619

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_024309229.1 Gene:ZNF619 / 285267 HGNCID:26910 Length:687 Species:Homo sapiens


Alignment Length:422 Identity:110/422 - (26%)
Similarity:175/422 - (41%) Gaps:79/422 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ESYDRAHGPQ----------AGCCTGASGELDFIEEVAEDCISEEVGEEDIVYADVPLWELVEEV 98
            |..:.|.||.          .|.|||...:.:..|:.|:..||:|.....::...     |:.:|
Human   185 EQGEAAWGPDPWTLAGGEALRGMCTGGKTKTENEEKTAQLNISKESESHRLIVEG-----LLMDV 244

  Fly    99 PANV----KAEKDQ-NEPSNSDRYFCYDCHSIFENRNKAEEHICPRAESGGSSQQDGDAKAPVRR 158
            |.:.    :.||.| ::..|..:  ..||..:     ..::|     ||..:.:::      :.|
Human   245 PQHPDFKDRLEKSQLHDTGNKTK--IGDCTDL-----TVQDH-----ESSTTEREE------IAR 291

  Fly   159 KLASVSART------GPRDASSVISCGICNTVFSSEKFLKFHMRIHENRAPKSIQDALPIGAHQQ 217
            ||...|..|      |.........||.|.:.::.......|.|:|.|..|              
Human   292 KLEESSVSTHLITKQGFAKEQVFYKCGECGSYYNPHSDFHLHQRVHTNEKP-------------- 342

  Fly   218 YSELDQFYCEICNKSFD-ETLLTVHKQMHQQESSEIMCSICNRKFENEVTYQMHQKIH--EKPRD 279
                  :.|:.|.|:|. .:.|:.|:::|..| ....|..|.:.|........|||:|  ::|.:
Human   343 ------YTCKECGKTFRYNSKLSRHQKIHTGE-KPYSCEECGQAFSQNSHLLQHQKLHGGQRPYE 400

  Fly   280 --------SESSRKLAQRTSLDKEKPGFPCQYCERVFTRPFEKVKHERVHTGEKPYACEVCGKTF 336
                    |.:|:.:..:.....||| |.|:.|.:.|:..::.:.|||:|.|||||.|:.|||:.
Human   401 CTDCGKTFSYNSKLIRHQRIHTGEKP-FKCKECGKAFSCSYDCIIHERIHNGEKPYECKECGKSL 464

  Fly   337 RVSYSLTLHLRTHTNIRPYVCTVCNKRFKSHQVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAH 401
            ..:..|..|.|.||..:||.|..|.|.|....|:..|.|.|:.|:.:.|:.|.|||..|.:...|
Human   465 SSNSVLIQHQRIHTGEKPYECKECGKAFHRSSVFLQHQRFHTGEQLYKCNECWKTFSCSSRFIVH 529

  Fly   402 KNTHT--KPYRCAVCNRPFSSMYAVKNHMQTH 431
            :..|.  |||.|..|.:.||....:..|.:.|
Human   530 QRIHNGEKPYECQECGKTFSQKITLVQHQRVH 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
zf-H2C2_2 316..336 CDD:290200 13/19 (68%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
zf-H2C2_2 341..366 CDD:290200 11/24 (46%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
C2H2 Zn finger 411..431 CDD:275368 5/19 (26%)
ZNF619XP_024309229.1 KRAB 19..59 CDD:307490
C2H2 Zn finger 317..337 CDD:275368 5/19 (26%)
COG5048 <327..485 CDD:227381 50/179 (28%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..393 CDD:275368 6/19 (32%)
C2H2 Zn finger 401..421 CDD:275368 2/19 (11%)
zf-H2C2_2 414..438 CDD:316026 7/24 (29%)
C2H2 Zn finger 429..449 CDD:275368 6/19 (32%)
C2H2 Zn finger 457..477 CDD:275368 7/19 (37%)
C2H2 Zn finger 485..505 CDD:275368 7/19 (37%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 529..550 CDD:316026 8/20 (40%)
C2H2 Zn finger 541..561 CDD:275368 5/19 (26%)
zf-H2C2_2 554..577 CDD:316026 2/8 (25%)
C2H2 Zn finger 569..589 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.