DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and Zbtb24

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_700447.2 Gene:Zbtb24 / 268294 MGIID:3039618 Length:710 Species:Mus musculus


Alignment Length:628 Identity:143/628 - (22%)
Similarity:201/628 - (32%) Gaps:190/628 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TPNLHVEDGDLSGGALQQEFLYCESCGNVYEDTESYDRAHGPQAGCCTG---------------- 59
            |..||..:..........:||........|.|.:....|..|.|..|||                
Mouse    96 TGYLHASEKTTEQILATAQFLKVYDLVKAYADFQDNHSAPKPPALNCTGTPVVVISNKKNDPLKR 160

  Fly    60 -------------------ASGEL------------DFI----------EEVAEDCISEEVGEED 83
                               |.|||            :|:          |:..||..||..||..
Mouse   161 KRGRPRKANGLQEGRSELAAEGELQLRVNNSVQNRQNFVFKEEDSVKLSEQTPEDKESEPAGEPG 225

  Fly    84 IVYADVPLWELVEEVPANVKAEKDQNEPSNSDRYFCYDCHSIFENRNKAEEHICPRAESGGSSQQ 148
                      .|||||    ||||:|          :|                |:|..|..||.
Mouse   226 ----------SVEEVP----AEKDEN----------FD----------------PKAGDGQESQS 250

  Fly   149 --------------------DGDAKAPVRRKLASVSARTGPRDASSVISCGICNTVFSSEKFLKF 193
                                |.|.::..:|........:||.     ..|..|:.||....||..
Mouse   251 RCSRRRIRRSVKLKDYKLLGDEDDQSTAKRLCGRKKRSSGPE-----ARCKDCDRVFKYSHFLAI 310

  Fly   194 HMRIHENRAPKSIQDALPIGAHQQYSELDQFYCEICNKSF-DETLLTVHKQMHQQESSEIMCSIC 257
            |.|.|....|                    |.|..|.|.| .:..|.||.:||..| ....|::|
Mouse   311 HQRRHTGERP--------------------FKCNECGKGFAQKHSLQVHTRMHTGE-RPYTCTVC 354

  Fly   258 NRKFENEVTYQMHQKIHEKPRDSESSRKLAQRTSLDKEKPGFPCQYCERVFTRPFEKVKHERVHT 322
            .:....:.:...|..:|       |.:|            .|.|..|.:.|::..:...|.||||
Mouse   355 GKALTTKHSLLEHMSLH-------SGQK------------SFTCDQCGKYFSQKRQLKSHYRVHT 400

  Fly   323 GEKPYACEVCGKTFRVSYSLTLHLRTHTNIRPYVCTVCNKRFKSHQVYSHHLRIHSSERQFSCDA 387
            |.....|..|.:.|.....|..||||||..:|:.|.:|.|.|.:......|:|||..|:.:||..
Mouse   401 GHSLPECSHCHRKFMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCSI 465

  Fly   388 CPKTFRTSVQLYAHKNTHT--KPYRCAVCNRPFSSMYAVKNHMQTH-KEISSKGSVGSGTPNIKS 449
            |.|.|..|.....|...||  ||:.|..|...|:.:..:|.|::.| ||              |.
Mouse   466 CGKCFSDSSAKRRHCILHTGKKPFSCPECGLQFARLDNLKAHLKIHSKE--------------KH 516

  Fly   450 AATSKSQAAGKFYCNTCGAEYARLFALRLHMKSAHGLVEEQENPATSTDAAH-VAETDDSETAVL 513
            .|.|.|.:....      .|...:..|:.:..|..|   |||.....||:.| :.........|.
Mouse   517 TADSSSVSGSNV------DEGRNILQLQPYQLSTSG---EQEIQLLVTDSVHNINFMPGPSQGVS 572

  Fly   514 IAAAEADAAYINAVVNDVDIVGTVPTYEECVVFDVDNFHSEEV 556
            |.|||:..:.......::.::...|...:.::.......:|.:
Mouse   573 IVAAESPQSMATDPAANITLLTQQPEQLQGLILSAQQEQAEHI 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 3/19 (16%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
zf-H2C2_2 316..336 CDD:290200 8/19 (42%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
zf-H2C2_2 341..366 CDD:290200 12/24 (50%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
C2H2 Zn finger 411..431 CDD:275368 5/19 (26%)
Zbtb24NP_700447.2 BTB 27..128 CDD:279045 6/31 (19%)
BTB 38..133 CDD:197585 7/36 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..176 6/41 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..256 23/93 (25%)
C2H2 Zn finger 295..315 CDD:275368 8/19 (42%)
zf-H2C2_2 308..332 CDD:290200 10/43 (23%)
COG5048 <320..479 CDD:227381 54/198 (27%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 335..360 CDD:290200 8/25 (32%)
C2H2 Zn finger 351..371 CDD:275368 3/19 (16%)
zf-H2C2_2 363..388 CDD:290200 8/43 (19%)
C2H2 Zn finger 379..399 CDD:275368 5/19 (26%)
COG5048 406..>563 CDD:227381 53/179 (30%)
C2H2 Zn finger 407..427 CDD:275368 7/19 (37%)
zf-H2C2_2 420..443 CDD:290200 11/22 (50%)
C2H2 Zn finger 435..455 CDD:275368 6/19 (32%)
zf-H2C2_2 447..471 CDD:290200 9/23 (39%)
C2H2 Zn finger 463..479 CDD:275368 5/15 (33%)
zf-H2C2_2 477..500 CDD:290200 8/22 (36%)
C2H2 Zn finger 491..511 CDD:275368 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 651..676
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.