DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and POGZ

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_016856233.1 Gene:POGZ / 23126 HGNCID:18801 Length:1417 Species:Homo sapiens


Alignment Length:463 Identity:94/463 - (20%)
Similarity:140/463 - (30%) Gaps:177/463 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GDAKAPV---RRKLASVSART-GPRDASSVIS--------------CGICNTVFSSEKFLKFHM- 195
            |.:..||   ....|..|.|| ||..:..|.|              |..||..|...:.|:.|| 
Human   338 GQSPGPVVVSNNSSAHGSQRTSGPESSMKVTSSIPVFDLQDGGRKICPRCNAQFRVTEALRGHMC 402

  Fly   196 -----RIHENRAPKSI--QDALPIGAHQQYSE--------------------------------- 220
                 .:...:..||:  :.::|..|.....|                                 
Human   403 YCCPEMVEYQKKGKSLDSEPSVPSAAKPPSPEKTAPVASTPSSTPIPALSPPTKVPEPNENVGDA 467

  Fly   221 --------LDQFY--------CEICNKSFDETLLTVHKQMHQQESSEIMCSICNRKFENEVTYQM 269
                    :|.||        .::.|              ..:.::...|..|.::.:|.:.:..
Human   468 VQTKLIMLVDDFYYGRDGGKVAQLTN--------------FPKVATSFRCPHCTKRLKNNIRFMN 518

  Fly   270 HQKIHEKPRDSESSRKLAQRTSLDK---EKPGFP-CQYCERVFTRPFEKVKH-ERVHTGEKPY-- 327
            |.|.|               ..||:   |..|.. ||:|.|.|:.||:...| |.||:   ||  
Human   519 HMKHH---------------VELDQQNGEVDGHTICQHCYRQFSTPFQLQCHLENVHS---PYES 565

  Fly   328 --ACEVCGKTFRVSYSLTLHLR-TH-TNIRPYVCTVCNKRFKSHQVYSHHLR-IHSSERQFSCDA 387
              .|::|...|........|:: || ....||||.||..|...:.....|.| ||...|...|..
Human   566 TTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPY 630

  Fly   388 CPKTFRTSVQLYAHKNTHTK--PYRCAVCNRPFSSMYA---VKNHMQTHK--------------- 432
            |.|.|:.......|...|.|  .|.|..|...|  ::|   :::.:|.||               
Human   631 CLKVFKNGNAFQQHYMRHQKRNVYHCNKCRLQF--LFAKDKIEHKLQHHKTFRKPKQLEGLKPGT 693

  Fly   433 EISSKGSVG---------SGTP---------------------------NIKSAATSKSQAAGKF 461
            :::.:.|.|         :.||                           :|:..|..|....|:.
Human   694 KVTIRASRGQPRTVPVSSNDTPPSALQEAAPLTSSMDPLPVFLYPPVQRSIQKRAVRKMSVMGRQ 758

  Fly   462 YCNTCGAE 469
            .|..|..|
Human   759 TCLECSFE 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
C2H2 Zn finger 301..321 CDD:275368 9/20 (45%)
zf-H2C2_2 316..336 CDD:290200 8/24 (33%)
C2H2 Zn finger 329..349 CDD:275368 4/20 (20%)
zf-H2C2_2 341..366 CDD:290200 10/26 (38%)
C2H2 Zn finger 357..377 CDD:275368 6/20 (30%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
C2H2 Zn finger 411..431 CDD:275368 5/22 (23%)
POGZXP_016856233.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.