DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Opbp and che-1

DIOPT Version :9

Sequence 1:	NP_724479.1	Gene:	Opbp / 246618	FlyBaseID:	FBgn0050443	Length:	562	Species:	Drosophila melanogaster
Sequence 2:	NP_001076598.1	Gene:	che-1 / 183847	WormBaseID:	WBGene00000483	Length:	273	Species:	Caenorhabditis elegans

Alignment Length:	134	Identity:	49/134 - (36%)
Similarity:	66/134 - (49%)	Gaps:	7/134 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   279 DSESSRKLAQRTSLDKEKP-------GFPCQYCERVFTRPFEKVKHERVHTGEKPYACEVCGKTF 336
            |...|.:|.::..|..::|       .|.||.|.:.|::......|:|:||||||:.|.||.:.|
Worm   139 DPTPSLRLPKKEPLPVQRPMARSTPKPFRCQTCGKAFSQAANLTAHKRIHTGEKPFMCPVCNRPF 203

  Fly   337 RVSYSLTLHLRTHTNIRPYVCTVCNKRFKSHQVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAH 401
            ..|.||..|.||||..|||.|..|.|.|......:.|||.|:..:.:.|..|...|..|..|:.|
Worm   204 SQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRH 268

  Fly   402 KNTH 405
            ..||
Worm   269 MKTH 272

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Opbp	NP_724479.1	C2H2 Zn finger	254..274	CDD:275368
		C2H2 Zn finger	301..321	CDD:275368	6/19 (32%)
		zf-H2C2_2	316..336	CDD:290200	11/19 (58%)
		C2H2 Zn finger	329..349	CDD:275368	9/19 (47%)
		zf-H2C2_2	341..366	CDD:290200	14/24 (58%)
		C2H2 Zn finger	357..377	CDD:275368	7/19 (37%)
		C2H2 Zn finger	385..405	CDD:275368	6/19 (32%)
		C2H2 Zn finger	411..431	CDD:275368
che-1	NP_001076598.1	zf-C2H2	166..188	CDD:278523	7/21 (33%)
		C2H2 Zn finger	168..188	CDD:275368	6/19 (32%)
		zf-H2C2_2	180..205	CDD:290200	12/24 (50%)
		C2H2 Zn finger	196..216	CDD:275368	9/19 (47%)
		zf-H2C2_2	208..232	CDD:290200	13/23 (57%)
		C2H2 Zn finger	224..244	CDD:275368	7/19 (37%)
		zf-H2C2_2	237..261	CDD:290200	7/23 (30%)
		C2H2 Zn finger	252..272	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910