DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and hinf-1

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_493579.2 Gene:hinf-1 / 173348 WormBaseID:WBGene00009553 Length:541 Species:Caenorhabditis elegans


Alignment Length:478 Identity:99/478 - (20%)
Similarity:157/478 - (32%) Gaps:145/478 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 HSIFENRNKAEEHICPRAESGGSSQQDG----------------DAKAPVRRKLASVSARTG--- 168
            |....::::.::|:....:|..|..||.                ....|...:.:|..:.:|   
 Worm    50 HHHHHHQHQPQQHLHYMIDSQDSDSQDSVDSFRTPAPISSATRFSTHTPRASRASSNDSESGELS 114

  Fly   169 -------------------PRDASSVISCGICNTVFSSEKFLKFHMRIHENRAPKSIQDALPIGA 214
                               |:..:.|...|.|.:..||:.....|:..|.:...:.:|:    |.
 Worm   115 EEVMNHWLPMTWCERSSDDPQVFTFVCLWGQCVSSSSSKDEFVDHLFGHVSVIEEGVQN----GN 175

  Fly   215 HQQYSELDQFYCEI--CNKSFDETL-LTVHKQMH------QQESSEIM----------------C 254
            |     ::...|::  |||..|... |..|..||      ||:.||.:                |
 Worm   176 H-----MNTVQCKVRGCNKHLDSIFQLHRHVSMHVFQADCQQKGSEALIEKEDYIGIESCGFEPC 235

  Fly   255 S-------ICNRKFE------NEVTYQMHQKIHEKPRDSESSRKLAQRTSLDKEKPGFPCQY--C 304
            :       :.|.::|      |.:|.......|......:..| :.|..|...:|..|||::  |
 Worm   236 TNINYEGMLLNCQWEDCGMPFNSLTELFDHVGHHIDGVGDVDR-IQQNFSNGDKKVVFPCKWTAC 299

  Fly   305 ERVFTRPFEKVKHERVHTGEKPYACEVCGKTFRVSYSLTLHLRTHTNIR-------PYVCTVCNK 362
            .:|........:|.|.|:|||..||..|.:.|.....|..|....|.:.       ||:|.:|.|
 Worm   300 TQVADSKANLRRHARHHSGEKVLACPFCARFFSRRDKLYDHCLRRTILMKNPEMEDPYLCKLCQK 364

  Fly   363 RFKSH---------------------------QVYSHHLRIHS-SERQFSCDACPKTFRTSVQLY 399
            ||.:.                           :::.|.:..|| ..:.|.||.|.|.|.|..:|.
 Worm   365 RFGTEKALCMHVTRHLVSLTCPLCSLGLGCRAELHRHLMTKHSRRSKDFKCDTCSKLFFTESELN 429

  Fly   400 AHKNTHTK-PYRCAVCNRPFSSMYAVKNHMQTHKEISSKGSVGSGTPNIKSAATSKSQAAGKFYC 463
            .|...|:. .|.|..|...|.....:..||:.|.|            |...:         .:.|
 Worm   430 RHAVYHSDVMYSCKHCPEKFKWKKQLMKHMKEHDE------------NFNPS---------PYTC 473

  Fly   464 NTCGAEYARLFALRLHMKSAHGL 486
            :.|...|...|||..|:...|.|
 Worm   474 HLCDRTYTTGFALGRHLTRQHRL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/32 (16%)
C2H2 Zn finger 301..321 CDD:275368 5/21 (24%)
zf-H2C2_2 316..336 CDD:290200 9/19 (47%)
C2H2 Zn finger 329..349 CDD:275368 5/19 (26%)
zf-H2C2_2 341..366 CDD:290200 10/31 (32%)
C2H2 Zn finger 357..377 CDD:275368 6/46 (13%)
C2H2 Zn finger 385..405 CDD:275368 8/19 (42%)
C2H2 Zn finger 411..431 CDD:275368 5/19 (26%)
hinf-1NP_493579.2 C2H2 Zn finger 299..316 CDD:275368 4/16 (25%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 359..379 CDD:275368 5/19 (26%)
C2H2 Zn finger 385..406 CDD:275368 1/20 (5%)
C2H2 Zn finger 415..435 CDD:275368 8/19 (42%)
C2H2 Zn finger 442..462 CDD:275368 5/19 (26%)
C2H2 Zn finger 473..494 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.