DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and ZNF418

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001303956.1 Gene:ZNF418 / 147686 HGNCID:20647 Length:697 Species:Homo sapiens


Alignment Length:517 Identity:140/517 - (27%)
Similarity:206/517 - (39%) Gaps:86/517 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SGGALQQEFLYCESCGNVYEDTES---YDRAHGPQAGCCTGASGELDFIEE----VAEDCISEEV 79
            |.|.|.||..:.....|...:.||   :...|.....|...:|.:..|:::    ..|:|...|.
Human   192 SSGLLLQEATHTGEKSNSKPECESPFQWGDTHYSCGECMKHSSTKHVFVQQQRLPSREECYCWEC 256

  Fly    80 GEEDIVYADVPLWELVEEVPANVKAEKDQNEPSNSDR-------YFCYDCHSIFENRNKAEEHIC 137
            |:....|..|                      ||..|       |.|.:|...|.::....:|  
Human   257 GKSFSKYDSV----------------------SNHQRVHTGKRPYECGECGKSFSHKGSLVQH-- 297

  Fly   138 PRAESGGSSQQDGDAKAPVRRKLASVS---ARTGPRDASSVISCGICNTVFSSEKFLKFHMRIHE 199
            .|..:|....:.|:.......|.:.|.   ..||.|.    ..||.|...||....|..|.|:|.
Human   298 QRVHTGKRPYECGECGKSFSHKGSLVQHQRVHTGERP----YECGECGKSFSQNGTLIKHQRVHT 358

  Fly   200 NRAPKSIQDALPIG----------AHQQYSELDQFY-CEICNKSFDET-LLTVHKQMHQQESSEI 252
            ...|...::.   |          .||:....::.| ||.|.|.|.:. .||.|.::|.:| ...
Human   359 GERPYECEEC---GKCFTQKGNLIQHQRGHTSERPYECEECGKCFSQKGTLTEHHRVHTRE-RPY 419

  Fly   253 MCSICNRKFENEVTYQMHQKIH--EKPRD-----SESSRK---LAQRTSLDKEKPGFPCQYCERV 307
            .|..|.:.|..:...:.||:.|  |:|.:     ...|||   :..:.|...|:| :.|:.|.::
Human   420 ECGECGKSFSRKGHLRNHQRGHTGERPYECGECGKSFSRKGNLIQHQRSHTGERP-YECRECRKL 483

  Fly   308 FTRPFEKVKHERVHTGEKPYACEVCGKTFRVSYSLTLHLRTHTNIRPYVCTVCNKRFKSHQVYSH 372
            |......::|:||||||:||.|..|||:|:.|....:|.|.||..:|:.|:.|.|.|........
Human   484 FRGKSHLIEHQRVHTGERPYECNECGKSFQDSSGFRVHQRVHTGEKPFECSECGKSFPQSCSLLR 548

  Fly   373 HLRIHSSERQFSCDACPKTFRTSVQLYAHKNTHT--KPYRCAVCNRPFSSMYAVKNHMQTHKEIS 435
            |.|:|:.||.:.|..|.|:|..|..|..|:.|||  :||.|..|.:.|||:.   .|.:.|....
Human   549 HRRVHTGERPYECGECGKSFHQSSSLLRHQKTHTAERPYECRECGKFFSSLL---EHRRVHTGER 610

  Fly   436 SKGSVGSGTPNIKSAATSKSQ---AAGKFY-CNTCGAEYARLFALRLHMKSAHGLVEEQENP 493
            .......|....:.:|..|.|   ..||.| |:.||..:|..|:|..|.:     |...|.|
Human   611 PYECRECGKTFTRRSAHFKHQRLHTRGKPYECSECGKSFAETFSLTEHRR-----VHTGERP 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
zf-H2C2_2 316..336 CDD:290200 13/19 (68%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 341..366 CDD:290200 9/24 (38%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
C2H2 Zn finger 411..431 CDD:275368 6/19 (32%)
ZNF418NP_001303956.1 KRAB 26..>67 CDD:214630
KRAB 26..65 CDD:279668
C2H2 Zn finger 105..125 CDD:275368
C2H2 Zn finger 253..273 CDD:275368 7/41 (17%)
C2H2 Zn finger 281..301 CDD:275368 5/21 (24%)
zf-H2C2_2 293..318 CDD:290200 4/26 (15%)
COG5048 304..692 CDD:227381 112/381 (29%)
C2H2 Zn finger 309..329 CDD:275368 3/19 (16%)
zf-H2C2_2 321..346 CDD:290200 8/28 (29%)
C2H2 Zn finger 337..357 CDD:275368 8/19 (42%)
zf-H2C2_2 350..374 CDD:290200 6/26 (23%)
C2H2 Zn finger 365..385 CDD:275368 3/22 (14%)
C2H2 Zn finger 393..413 CDD:275368 8/19 (42%)
C2H2 Zn finger 421..441 CDD:275368 5/19 (26%)
zf-H2C2_2 433..458 CDD:290200 5/24 (21%)
C2H2 Zn finger 449..469 CDD:275368 3/19 (16%)
C2H2 Zn finger 477..497 CDD:275368 5/19 (26%)
zf-H2C2_2 489..512 CDD:290200 13/22 (59%)
C2H2 Zn finger 505..525 CDD:275368 8/19 (42%)
zf-H2C2_2 518..540 CDD:290200 8/21 (38%)
C2H2 Zn finger 533..553 CDD:275368 6/19 (32%)
zf-H2C2_2 545..570 CDD:290200 9/24 (38%)
C2H2 Zn finger 561..581 CDD:275368 7/19 (37%)
zf-H2C2_2 573..598 CDD:290200 10/24 (42%)
C2H2 Zn finger 589..606 CDD:275368 6/19 (32%)
zf-H2C2_2 598..623 CDD:290200 4/27 (15%)
C2H2 Zn finger 614..634 CDD:275368 4/19 (21%)
C2H2 Zn finger 642..662 CDD:275368 7/24 (29%)
zf-H2C2_2 654..679 CDD:290200 5/19 (26%)
C2H2 Zn finger 670..690 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.