DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and ZNF280A

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_542778.2 Gene:ZNF280A / 129025 HGNCID:18597 Length:542 Species:Homo sapiens


Alignment Length:382 Identity:89/382 - (23%)
Similarity:146/382 - (38%) Gaps:93/382 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 GGSSQQDGDAKAPVRRKLASVSARTG------------------PRDASSVISC-----GICNTV 184
            ||.::...|:|   |...:.:::|..                  |.|.||.||.     ||||:.
Human   156 GGRNESSPDSK---RLSTSDINSRDSKRVKLRDGIPGVPSLAVVPSDMSSTISTNTPSQGICNSS 217

  Fly   185 FSSEKFLKFHMRIHENRAPKSIQDALPIGAHQQYSELDQFYCEIC-----NKSFDE------TLL 238
            ...:..:.|.......:|..::.|.      ::.||......:|.     ||:||.      .||
Human   218 NHVQNGVTFPWPDANGKAHFNLTDP------ERASESALAMTDISSLASQNKTFDPKKENPIVLL 276

  Fly   239 T-----VHK---QMHQQESSEIMCSICNRKFENEVTYQMHQKIH---EKPRDSESSRKLAQRTSL 292
            :     .||   |..|:..:...|..|.:..:| :.:..|.|.|   ||.|:             
Human   277 SDFYYGQHKGDGQPEQKTHTTFKCLSCVKVLKN-IKFMNHMKHHLEFEKQRN------------- 327

  Fly   293 DKEKPGFPCQYCERVFTRPFEKVKH-ERVHTGEKPYA-CEVCGKTFRVSYSLTLHLRTH--TNIR 353
            |..:....||:|.|.|..||:...| :.||....|.| |::|..:|.....|..|::.|  ....
Human   328 DSWEDHTTCQHCHRQFPTPFQLQCHIDSVHIAMGPSAVCKICELSFETDQVLLQHMKDHHKPGEM 392

  Fly   354 PYVCTVCNKRFKSH-QVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAH--KNTHTKPYRCAVCN 415
            ||||.||:.|.... .|.:|....|.:.:...|..|.|.|:|::....|  :::..:..:|:.|.
Human   393 PYVCQVCHYRSSVFADVETHFRTCHENTKNLLCLFCLKLFKTAIPYMNHCWRHSRRRVLQCSKCR 457

  Fly   416 RPFSSM-----YAVKNHMQTHK------------EISSKGSVGSGTPNIKSAATSKS 455
            ..|.::     :..|:| ||.|            ::..:.||..|:..:.|...|.:
Human   458 LQFLTLKEEIEHKTKDH-QTFKKPEQLQGLPSETKVIIQTSVQPGSSGMASVIVSNT 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
C2H2 Zn finger 301..321 CDD:275368 8/20 (40%)
zf-H2C2_2 316..336 CDD:290200 7/21 (33%)
C2H2 Zn finger 329..349 CDD:275368 5/19 (26%)
zf-H2C2_2 341..366 CDD:290200 10/26 (38%)
C2H2 Zn finger 357..377 CDD:275368 6/20 (30%)
C2H2 Zn finger 385..405 CDD:275368 6/21 (29%)
C2H2 Zn finger 411..431 CDD:275368 6/24 (25%)
ZNF280ANP_542778.2 DUF4195 47..217 CDD:316361 16/63 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 105..185 6/31 (19%)
C2H2 Zn finger 336..357 CDD:275368 8/20 (40%)
C2H2 Zn finger 366..386 CDD:275368 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..542 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.