DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and pogza

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001201839.1 Gene:pogza / 100535215 ZFINID:ZDB-GENE-040914-76 Length:1277 Species:Danio rerio


Alignment Length:371 Identity:77/371 - (20%)
Similarity:122/371 - (32%) Gaps:85/371 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VPLWELVEEVPANVKAEKDQNEPSNSDRYFCYDCHSIFENRNKAEEHICPRAESGGSSQQDGDAK 153
            :|..:::...|........:...|::   ||..|.::::.......:.|.      .||:     
Zfish   252 MPQMQILAPAPGTASNALKRTSSSST---FCPRCKAVYQKSLPLRGYFCQ------CSQE----- 302

  Fly   154 APVRRKLASVSARTGPRDASSVISCGICNTVFSSEKFLKFHMRIHENRAPKSIQDALPIGAHQQY 218
                                      :..:::|.:...|..:|....|.|:   |.....|..:.
Zfish   303 --------------------------LIKSIWSLKSHTKNRLRARSKRPPR---DTPASSASSKT 338

  Fly   219 SELDQFYCEI-------CNKSFDE---TLLTVHKQMHQQ------------ESSEIMCSICNRKF 261
            |:.|...||:       .:..|||   .::.|....:.|            |...:.|.:|::|.
Zfish   339 SQKDVTSCELPEGAPNPRSGDFDEQGRMIMLVEDFFYGQHPGRPADVRYPWEHISMKCHLCSKKL 403

  Fly   262 ENEVTYQMHQKIHEKPRDSESSRKLAQRTSLDKEKPGFPCQYCERVFTRPFEKVKH-ERVH-TGE 324
            ...:....|.| |...||..:........          ||:|.|.|:.||....| |.|| ..|
Zfish   404 IGNIEMMNHMK-HHMERDCRTGEVDCHTV----------CQHCYRNFSTPFGLQCHVEAVHIQAE 457

  Fly   325 KPYACEVCGKTFRVSYSLTLHLRTHTN---IRPYVCTVCNKRFKSHQ-VYSHHLRIHSSERQFSC 385
            ....|::|...|. |..|.|:...|.:   ..||||.||:.|...:: |.:|....|.......|
Zfish   458 SSKVCKICECLFE-SEPLFLNHMKHVHKPGEMPYVCKVCDFRSSFYKDVMNHFTEHHKDTCILLC 521

  Fly   386 DACPKTFRTSVQLYAHKNTHTK--PYRCAVCNRPFSSMYAVKNHMQ 429
            ..|.|.||:......|...|.|  ...|..|...|.|.....:|.|
Zfish   522 VYCLKIFRSCGGFQLHYTRHQKKGARNCDKCRLQFCSEKDEWHHKQ 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
C2H2 Zn finger 301..321 CDD:275368 9/20 (45%)
zf-H2C2_2 316..336 CDD:290200 7/21 (33%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 341..366 CDD:290200 10/27 (37%)
C2H2 Zn finger 357..377 CDD:275368 6/20 (30%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
C2H2 Zn finger 411..431 CDD:275368 6/19 (32%)
pogzaNP_001201839.1 C2H2 Zn finger 432..453 CDD:275368 9/20 (45%)
C2H2 Zn finger 462..483 CDD:275368 7/21 (33%)
rve 1027..>1134 CDD:304425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.