DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Opbp and Zfp951

DIOPT Version :9

Sequence 1:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_017455044.1 Gene:Zfp951 / 100188984 RGDID:2301011 Length:423 Species:Rattus norvegicus


Alignment Length:462 Identity:119/462 - (25%)
Similarity:167/462 - (36%) Gaps:137/462 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ETTPNLHVEDGDLSGGALQQEFLYCESCGNVYEDTESYDRAHGPQAGCCTGASGELDFIEEVAED 73
            ||..||      .:.|:..:|.:..|:|.|        .|.||          ..||:.|.:...
  Rat    58 ETYENL------TAIGSYWEEHIIEENCQN--------SRRHG----------SHLDWNERIHTG 98

  Fly    74 CISEEVGE-------------------EDIVYADVPLWELVEEVPANVKAEKDQ-----NEPSN- 113
            ..:.||.:                   |..||        ...|..|.||:..:     |:..| 
  Rat    99 EKTNEVVQYKEGFASQNHLHTHKSTLTEPFVY--------YSTVQVNRKAQTGEKPGGFNQCENA 155

  Fly   114 --SDRYF-CY------DCHSIFENRNKAEEHICPRAESGGSSQQDGDAKAPVRRKLASVSARTGP 169
              |:.|. |:      :.|.....|.||...||        |.|:              ..:|.|
  Rat   156 FLSNTYLRCHKKSHTTEKHYACNQRCKAFAQIC--------SPQN--------------HTKTHP 198

  Fly   170 RDASSVISCGICNTVFSSEKFLKFHMRIHENRAPKSIQDALPIGAHQQYSELDQFYCEICNKSF- 233
            .:  ....|..|:.||||.|.|:.|.:.|....|                    :.|..|.|:| 
  Rat   199 EE--KPYECNQCSKVFSSHKSLQAHKKTHTGEKP--------------------YTCNQCGKAFA 241

  Fly   234 DETLLTVHKQMHQQESSEIMCSICNRKFENEVTYQMHQKIH--EKPRDSESSRKLAQRTSLDKEK 296
            ....|..||..|..| ....|:.|.:.|..:...::|.:.|  |||                   
  Rat   242 KHAHLQRHKSTHTGE-KPYECNQCGKAFACQSYLRIHTRTHTGEKP------------------- 286

  Fly   297 PGFPCQYCERVFTRPFEKVKHERVHTGEKPYACEVCGKTFRVSYSLTLHLRTHTNIRPYVCTVCN 361
              :.|..|.:|||.......|:|.|||||||||..|||.|........|.||||..:|:.|..|.
  Rat   287 --YQCNQCGKVFTWQSILQSHKRTHTGEKPYACNQCGKAFAHYSDFHRHTRTHTGKKPFECNQCG 349

  Fly   362 KRFKSHQVYSHHLRIHSSERQFSCDACPKTFRTSVQLYAHKNTHT--KPYRCAVCNRPFSSMYAV 424
            |.|..|....:|.|.|:.|:.:.|:.|.|.|.:...|..|:.|||  :||.|..|.:.|:....:
  Rat   350 KAFFRHSHLLNHQRTHTGEKPYECNQCGKAFVSQSNLQNHRRTHTGVRPYECNQCGKVFACHSNL 414

  Fly   425 KNHMQTH 431
            ::|.:||
  Rat   415 QSHKRTH 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 4/19 (21%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
zf-H2C2_2 316..336 CDD:290200 14/19 (74%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
zf-H2C2_2 341..366 CDD:290200 10/24 (42%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
C2H2 Zn finger 411..431 CDD:275368 4/19 (21%)
Zfp951XP_017455044.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.