DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IFT20 and IFT20

DIOPT Version :9

Sequence 1:NP_724409.3 Gene:IFT20 / 246616 FlyBaseID:FBgn0050441 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001254703.1 Gene:IFT20 / 90410 HGNCID:30989 Length:158 Species:Homo sapiens


Alignment Length:123 Identity:42/123 - (34%)
Similarity:72/123 - (58%) Gaps:0/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LQKVGVFIDEIYTVRVEHPNLSSSKIMFKQECFNYIKAFTIFKKFVFNYCNISETFAKDVDKEKL 68
            |.:.|:..||:..:||..|.::...|..|:||.:::.....|:|.|.....:.:..||:.:.||:
Human    32 LGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKM 96

  Fly    69 RAIGTQNQLKTAFIQRQNKQQVYQYEIFEQTVELERLKGELQFLQRIETEQHEIINNF 126
            :|||.:|.||:...||:.:||..|..|.|:.::|||.:.|.:.|.::|.||:|.|:.|
Human    97 KAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQF 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IFT20NP_724409.3 IFT20 8..126 CDD:291592 40/117 (34%)
IFT20NP_001254703.1 IFT20 37..145 CDD:405600 34/107 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147770
Domainoid 1 1.000 79 1.000 Domainoid score I8723
eggNOG 1 0.900 - - E1_2AFZ8
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49559
Inparanoid 1 1.050 81 1.000 Inparanoid score I5218
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56504
OrthoDB 1 1.010 - - D1589590at2759
OrthoFinder 1 1.000 - - FOG0007025
OrthoInspector 1 1.000 - - oto88925
orthoMCL 1 0.900 - - OOG6_104950
Panther 1 1.100 - - LDO PTHR31978
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4108
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.