DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IFT20 and ift20

DIOPT Version :9

Sequence 1:NP_724409.3 Gene:IFT20 / 246616 FlyBaseID:FBgn0050441 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001007902.1 Gene:ift20 / 493285 XenbaseID:XB-GENE-966387 Length:132 Species:Xenopus tropicalis


Alignment Length:125 Identity:39/125 - (31%)
Similarity:71/125 - (56%) Gaps:0/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EELQKVGVFIDEIYTVRVEHPNLSSSKIMFKQECFNYIKAFTIFKKFVFNYCNISETFAKDVDKE 66
            :.|...|:..||:..:|:..|:::......|:||.:::.....|:|.|.....:.:..||:.:.|
 Frog     4 DSLSDAGLHFDELNKLRILDPDVAQQTNELKEECRDFVDKIGHFQKVVGGLIELVDELAKETENE 68

  Fly    67 KLRAIGTQNQLKTAFIQRQNKQQVYQYEIFEQTVELERLKGELQFLQRIETEQHEIINNF 126
            |::|||.:|.||:...||:.:||.....|.|:.::|||.:.|.:.|.::|.||:|.|:.|
 Frog    69 KMKAIGARNLLKSIAKQREAQQQQLYALIAEKKMQLERYRIEYEALCKVEAEQNEFIDQF 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IFT20NP_724409.3 IFT20 8..126 CDD:291592 37/117 (32%)
ift20NP_001007902.1 IFT20 11..119 CDD:405600 31/107 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9013
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49559
Inparanoid 1 1.050 76 1.000 Inparanoid score I5094
OMA 1 1.010 - - QHG56504
OrthoDB 1 1.010 - - D1589590at2759
OrthoFinder 1 1.000 - - FOG0007025
OrthoInspector 1 1.000 - - oto102794
Panther 1 1.100 - - LDO PTHR31978
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4108
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.