DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IFT20 and ift20

DIOPT Version :9

Sequence 1:NP_724409.3 Gene:IFT20 / 246616 FlyBaseID:FBgn0050441 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001001833.2 Gene:ift20 / 414930 ZFINID:ZDB-GENE-040614-2 Length:132 Species:Danio rerio


Alignment Length:129 Identity:42/129 - (32%)
Similarity:73/129 - (56%) Gaps:0/129 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EELQKVGVFIDEIYTVRVEHPNLSSSKIMFKQECFNYIKAFTIFKKFVFNYCNISETFAKDVDKE 66
            :.|.:.|:..||:..:||..|::|......|:||..::.....|:|.|.....:.:..||:.:.|
Zfish     4 DPLAEAGLHFDELNKLRVLEPDVSQKTTELKEECEEFVDKIGQFQKIVGGLIELVDELAKEAETE 68

  Fly    67 KLRAIGTQNQLKTAFIQRQNKQQVYQYEIFEQTVELERLKGELQFLQRIETEQHEIINNFFVNQ 130
            |::|||.:|.||:...||:.:.|..|..|.|:.::|||.:.|.:.||::|.||.|.|:.|.:.:
Zfish    69 KMKAIGARNLLKSVEKQREAQHQQLQALIAEKKMQLERYRIEYEALQKVEAEQSEFIDQFILQK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IFT20NP_724409.3 IFT20 8..126 CDD:291592 40/117 (34%)
ift20NP_001001833.2 IFT20 10..128 CDD:291592 40/117 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581605
Domainoid 1 1.000 79 1.000 Domainoid score I8640
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49559
Inparanoid 1 1.050 81 1.000 Inparanoid score I5196
OMA 1 1.010 - - QHG56504
OrthoDB 1 1.010 - - D1589590at2759
OrthoFinder 1 1.000 - - FOG0007025
OrthoInspector 1 1.000 - - oto40798
orthoMCL 1 0.900 - - OOG6_104950
Panther 1 1.100 - - LDO PTHR31978
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4108
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.